SecReT6
Protein ID: 397658361
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3359
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3530126..3531211 [-]
Producthypothetical protein
NoteTssG
UniProt IDI6W6R7
KEGG IDkoe:A225_3359
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-75, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|397658361|ref|YP_006499063.1| hypothetical protein A225_3359 [Klebsiella oxytoca E718]
MGREAQPPHSRLSPRLAADLHRMNFYRFCQLLEKRNPDRPLMGSTSHPADDPVRFAPHPGMGFPGSELKA
VEYDEDDDSRPPLIRTTFMGMYGVDSPLPTAYLDDITQCREGHEVLQGFLDIFSHRILTQFYRIWRKYSY
PATFEAGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLRQPGKTQEGMQALVRLLAPDTTVQV
SPYCLRPVEIGQPLGFYGDDDFLLDGNTPLGEEAMDAGSQLLVALRTDNEQEAQGWKPDGLLYQDFLVML
RVYLGWRFKARITLTTRTRLLAVPPLGEEPFWLGMNGVLGAEEGAFADDLPLTFTTELGYYTGLAPAKPQ
QGNRRAKYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3531211-3530126 Klebsiella oxytoca E718 chromosome, complete genome
ATGGGAAGAGAAGCACAACCGCCGCATTCCCGGCTGAGCCCGCGGCTGGCAGCCGACCTGCACCGCATGA
ATTTTTATCGCTTCTGCCAGCTTCTGGAGAAGCGTAATCCGGACAGGCCGCTGATGGGGTCAACCAGCCA
CCCTGCTGATGACCCGGTGCGGTTTGCGCCGCATCCGGGGATGGGGTTTCCGGGCAGCGAACTGAAAGCT
GTCGAATATGACGAGGATGATGACAGCAGGCCACCGCTCATCCGCACAACCTTTATGGGGATGTACGGTG
TCGACTCACCCCTGCCGACAGCCTATCTTGATGACATCACTCAGTGCCGTGAAGGGCATGAGGTGCTACA
GGGCTTTCTGGATATCTTCAGCCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGGAAATACTCTTAT
CCGGCCACGTTTGAGGCAGGGGGAACTGACAGCATTTCGCAGTCGCTGCTGGGTCTGGTGGGGCTGGGCA
TACCGGGAACCGCAAACCACATCGCCACACCGGTATCCCGCTTTCTGGCGCTGCTCGGTGTGCTGCGCCA
ACCCGGCAAAACCCAGGAGGGGATGCAGGCGCTGGTGAGACTGCTGGCCCCGGATACTACGGTGCAGGTG
AGTCCGTACTGCCTGCGGCCGGTGGAGATCGGCCAGCCGCTGGGTTTTTACGGCGATGACGATTTTCTGC
TGGACGGCAATACGCCGCTGGGGGAAGAAGCGATGGATGCGGGCAGTCAACTGCTGGTTGCGCTCAGGAC
GGATAACGAACAGGAAGCGCAGGGCTGGAAACCGGATGGTCTGCTGTATCAGGATTTTCTGGTGATGCTG
CGTGTTTATCTCGGCTGGCGTTTTAAGGCCAGGATCACCCTGACCACCCGGACCCGACTGCTGGCCGTCC
CGCCGCTCGGCGAAGAACCTTTCTGGCTCGGCATGAACGGCGTGCTGGGAGCGGAGGAGGGGGCGTTTGC
GGACGATCTCCCGCTGACCTTTACGACAGAACTGGGTTACTACACCGGGCTGGCGCCTGCGAAACCACAA
CAAGGAAATCGACGTGCTAAGTACAAATTTGATTAA