SecReT6
Protein ID: 397658362
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3360
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3531175..3532929 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDI6X3Y3
KEGG IDkoe:A225_3360
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.50E-181, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|397658362|ref|YP_006499064.1| protein ImpG/VasA [Klebsiella oxytoca E718]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPQYLRTIPSMSVVEFTPDWREMKEKMRIVKGFEVNSQPIGEKATRCRYTTTKEISLQPLS
LEHARLSTAPDGRSVINLRFNCSHLADWSRADLSQIPFYFNADAPLACAMHEAFTMNTARLWLRMPGDTD
RKSLDGYFTALGFGDDDGLWPKDSSSFSGYQLLLEYFTFREKFMFTALRGLETVVFPAELAWFEIDVVLA
ERWEHDFSFTEKHLRLNCVPVINLFPLESDPLTLNSLQTEYMLRPMRVQDGHTEIYAVDSVISSSQHTYV
PFSSFRHKGGMMRHEAPEYYYHTRVRRGPSGLYNTWLILGGEAFDNHTVPENESLSLTLTGTNGQLPRRA
LQSTVLDTVMKSTSASVAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAIIDVKHSETGRFEQGYLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3532929-3531175 Klebsiella oxytoca E718 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTACGACGCCGAAATGCGCTACCTGCTGGAAGCCGGCGAAGAGTTTG
CCCGCGCTCACCCCGAGCAGGCGGCAATGCTCAATCTCGATAAAGCGGGTGCGCGCGACCCGTACGTGGA
GCGCCTGTTTGAGGGCTTTGCTTTCCTGATGGGTCGTCTTCGCGAGAAACTCGATGACGACCTGCCGGAA
CTGACCGAAGGGCTGGTCAGCCTGCTGTGGCCGCAATACCTGCGCACCATTCCGTCGATGTCGGTGGTGG
AGTTCACGCCCGACTGGCGCGAGATGAAAGAGAAGATGCGTATCGTCAAAGGTTTCGAGGTCAATTCGCA
GCCGATCGGCGAAAAGGCTACCCGCTGCCGATACACCACCACCAAAGAAATCTCCCTTCAGCCATTGTCG
CTGGAGCATGCCCGTCTGTCGACTGCCCCTGACGGGCGTTCGGTCATCAACCTGCGCTTTAACTGCAGCC
ATCTCGCCGACTGGAGTCGTGCCGATCTCAGCCAGATCCCGTTCTACTTCAATGCTGATGCACCGCTGGC
CTGCGCCATGCATGAAGCCTTTACCATGAACACGGCGCGTCTCTGGCTGCGGATGCCGGGTGACACGGAC
AGAAAGTCACTCGACGGGTATTTCACCGCGCTGGGATTCGGTGATGATGACGGGCTGTGGCCGAAGGACA
GCAGCAGCTTTAGCGGCTACCAGTTGCTGCTGGAGTACTTCACCTTCCGCGAAAAATTCATGTTCACGGC
TCTGCGCGGGCTGGAGACCGTAGTCTTTCCGGCTGAGCTCGCGTGGTTCGAAATCGACGTGGTGCTGGCC
GAGCGCTGGGAGCATGACTTCAGCTTTACCGAAAAACATCTGCGCCTGAACTGTGTGCCGGTGATTAACC
TGTTTCCGCTGGAATCTGACCCGCTGACGCTGAATTCACTGCAGACCGAATACATGCTGCGCCCGATGCG
CGTGCAGGATGGCCATACCGAGATTTATGCTGTCGATTCGGTGATATCCTCAAGCCAGCATACCTATGTA
CCGTTCTCCAGTTTCCGCCACAAAGGCGGCATGATGCGCCATGAAGCGCCGGAATATTACTACCACACCC
GCGTGCGCCGCGGTCCGTCAGGACTGTATAACACCTGGCTTATCCTCGGCGGCGAAGCCTTTGATAATCA
CACGGTGCCGGAAAACGAAAGCCTGTCCCTCACGCTCACCGGTACCAATGGCCAGCTGCCGCGACGCGCA
TTACAAAGCACCGTGCTGGATACGGTGATGAAAAGCACCTCGGCCAGCGTCGCCGTGCGTAACCTGTGTG
CGCCGACGCTGCCCTGCTATCCCCCGGCACAGGACCGTTTTCACTGGCGCGTGCTGAGCCACCTCGGCAG
CGGGTTTCTGTCGATGATGGATAATGCCGATGTGCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAACCGCCGTCGCCTGGAAGCCATTATTGACGTGAAGCACAGTGAGACCGGGCGATTTGAGC
AGGGCTACCTGGTACGCGGCGTGCAGATTGAGGTGACGCTCGACAGCCACGGCTTTGCCGGGCGCGGCGA
CATCTGCCTGTTCGGCGAGATGCTGAGCCGCTTCTTCGCGCTCTACACCGACATCTATCTGTTTAACCGC
CTGATTATTATTCTGCAACCGACCGGAGAGCGCCTGGAATGGGAAGAGAAGCACAACCGCCGCATTCCCG
GCTGA