SecReT6
Protein ID: 397658374
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3373
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3554117..3556459 [-]
ProductVgrG protein
NoteTssI
UniProt IDI6X0X2
KEGG IDkoe:A225_3373
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.50E-65, Aligned region: 34..356
Phage_GPD [PF05954], Evalue: 9.50E-65, Aligned region: 581..608
DUF2345 [PF10106], Evalue: 7.40E-41, Aligned region: 382..402
DUF2345 [PF10106], Evalue: 7.40E-41, Aligned region: 608..756
T6SS_Vgr [PF13296], Evalue: 1.20E-35, Aligned region: 489..593
Phage_base_V [PF04717], Evalue: 5.00E-17, Aligned region: 388..482
SlyX [PF04102], Evalue: 0.005, Aligned region: 583..622
Protein Sequence: 780 a.a.     [Download]
>gi|397658374|ref|YP_006499076.1| VgrG protein [Klebsiella oxytoca E718]
MSNNPPLRFSHSHHLLSVKGCDAEPDVLAFEGDEALSKPFRYRIEFTSADHTISKEMMLMKAASLTLQAP
VDQGYGIKIQQPVRVIQGVVTGFERLGTSKDETRYALTLEPRLALLDRSHQNAIYQDMSVPQIVEKILRE
RHNMRGQDFLFSLSKEYPRREQVMQYGENDLHFITRLLGEVGLWFRFTTDTRLNIDVVEFYDSQQGYEKG
LTLPSAPPSGQHSQGVDSVWEMESHHNVVQKQVSTRDYNYRQATEDMNTLVDATRGDATTYGEAYHWADN
YLTAGNSHDRNPAPESGAFYARIRHERYLNGQTQTRAVTSCPTLSPGMLLKVTGGYEVAEVFAQGVVITA
MHSHARRDEDFGIRFDGIPDSPDFSFRPAPGSRPVMAGTVPARVTSTTENDTYGHIDKDGRYRVNMLFDR
DSWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNYKRN
VLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSKKQQRGEGFELRTDRWGAIRAQQGIFITA
DAQIKGQGQVLAMDAALGTLNQAQQLAKSLSDAVATAQAELAQIQAQKTLLGSSLKDLQQSALLMSAPDG
IAQVSPQSIQISSGQNFIQTSGENSDFSVFKKFTVAAGEIISLFAKTLGIKMYANKGKVDIQAQGDAMML
TSLKSMTIISKDDEVVIQASKKITLCCGKTAVVIDPSGVNILTPGDVNAKSASLNHLASQSFSPAQPELP
PAASCVESAL
 
Nucleotide Sequence: 2343 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3556459-3554117 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGCAATAATCCTCCGTTAAGATTCAGCCACAGCCATCATCTGCTTTCGGTGAAAGGCTGTGACGCCG
AGCCCGATGTACTGGCGTTTGAAGGCGATGAAGCCCTGAGCAAACCCTTCCGCTACCGTATTGAGTTCAC
CAGCGCTGACCATACCATCAGCAAAGAGATGATGCTGATGAAAGCGGCTTCCCTGACGCTGCAGGCCCCG
GTTGACCAGGGCTACGGCATCAAAATCCAGCAGCCGGTGCGGGTGATTCAGGGAGTGGTGACGGGTTTTG
AACGCCTGGGCACCTCAAAGGACGAAACCCGCTACGCCCTGACGCTTGAGCCACGCCTGGCGCTGCTTGA
CCGTTCGCACCAGAACGCCATTTATCAGGACATGTCGGTCCCACAAATCGTGGAAAAAATTCTGCGCGAG
CGTCACAACATGCGCGGTCAGGATTTTCTGTTCTCGCTCTCAAAAGAGTATCCGCGCCGTGAACAGGTGA
TGCAGTACGGTGAGAACGACCTGCACTTTATCACCCGCCTGCTGGGTGAGGTCGGTCTCTGGTTTCGTTT
TACCACCGACACGCGGCTGAACATCGACGTGGTGGAGTTTTACGACAGCCAGCAGGGGTATGAAAAAGGC
CTGACGCTGCCGTCGGCGCCGCCATCCGGGCAGCATTCGCAGGGTGTGGACTCGGTGTGGGAGATGGAGA
GCCATCATAACGTGGTGCAGAAGCAGGTCAGCACCCGCGATTACAACTACCGCCAGGCCACGGAAGACAT
GAACACCCTCGTTGATGCGACCAGGGGAGATGCCACCACTTACGGAGAGGCCTATCACTGGGCGGATAAC
TACCTGACGGCGGGAAACTCCCATGACCGTAATCCGGCACCGGAGTCCGGGGCGTTCTATGCCCGCATTC
GTCACGAACGCTACCTGAATGGCCAGACGCAGACCCGGGCCGTCACCAGCTGCCCGACCCTCTCTCCGGG
GATGCTGCTGAAAGTCACCGGCGGGTACGAAGTGGCTGAGGTGTTTGCGCAGGGCGTGGTCATCACGGCG
ATGCACAGCCATGCGCGGCGTGATGAGGACTTTGGCATAAGGTTTGACGGTATCCCGGACAGCCCGGATT
TTAGTTTCCGCCCGGCGCCCGGCAGTCGTCCGGTGATGGCAGGCACCGTACCGGCCCGCGTCACCAGTAC
CACTGAAAATGACACCTACGGGCATATCGATAAGGACGGCCGCTACCGCGTCAACATGCTGTTTGACCGG
GACAGCTGGGAGACCGGATTCGAGAGCCTGTGGGTTCGTCAGTCCCGGCCGTATGCCGGGGACACTTACG
GTCTGCACTTGCCGCTGCTGGCAGGCACCGAAGTGGCGATTGGTTTTGAGGACGGTAACCCGGACCGGCC
GTACATCGCCGGGGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAACTACAAACGCAAC
GTCCTGCGCACGCCGGCAAACAACAAAATCCGCCTCGACGACGAGCGCGGGAAAGAGCATATCAAGGTCA
GCACGGAGTACGGCGGCAAGAGCCAGCTGAATCTCGGACATCTGGTCGACAGCAAGAAACAACAGCGCGG
GGAAGGTTTTGAGCTCAGGACGGACCGCTGGGGGGCTATTCGTGCACAGCAGGGTATTTTCATCACCGCA
GATGCACAAATCAAAGGTCAGGGACAGGTTCTGGCGATGGATGCGGCGCTGGGGACACTCAATCAGGCGC
AGCAGTTAGCGAAATCACTGAGCGATGCTGTAGCCACTGCACAGGCTGAACTCGCGCAGATCCAGGCGCA
AAAAACATTGCTGGGATCCTCTCTCAAGGATCTGCAGCAGTCCGCGTTGCTGATGAGCGCCCCGGACGGG
ATAGCTCAGGTATCACCGCAAAGCATCCAAATCAGCAGCGGACAGAACTTTATTCAGACCTCCGGCGAGA
ACAGTGACTTTAGCGTCTTCAAAAAATTCACCGTTGCGGCAGGCGAGATCATCAGCCTGTTTGCCAAAAC
GCTGGGCATCAAGATGTATGCCAATAAGGGTAAGGTTGATATTCAGGCACAAGGGGATGCAATGATGCTG
ACCTCCCTGAAAAGCATGACCATCATCAGTAAAGACGATGAGGTGGTGATTCAGGCAAGCAAGAAAATTA
CTTTATGTTGCGGTAAAACCGCTGTGGTCATCGACCCGTCTGGCGTCAATATTCTGACGCCTGGTGATGT
GAATGCCAAATCAGCCAGCCTGAACCATCTGGCATCACAGAGCTTCAGCCCGGCACAACCTGAACTGCCA
CCGGCGGCCAGTTGTGTGGAGAGTGCGCTCTGA