SecReT6
Protein ID: 397658377
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3376
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3557604..3559094 [-]
Productouter membrane protein
NoteTagL
UniProt IDI6X442, I6X442
KEGG IDkoe:A225_3376
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.70E-17, Aligned region: 366..462
Protein Sequence: 496 a.a.     [Download]
>gi|397658377|ref|YP_006499079.1| outer membrane protein [Klebsiella oxytoca E718]
MLVCGDLPLAWPHQSPVLIVPQGCWIRVEDHQDLEQVARQILWLRPDWGRQLSVMVCVCPQQHPDSEALT
SRLMTLRWRISQLRKETGHSVPLILNGQVGSAMTNDLFWQMALPGEGVRVWRESSVPGSVAAWVTAGGTP
AMQQQVLMNSLMSWFHQHVQAVFMDENPDVPVIAPTAVVWGMRPILAGSLATSAWTAWLSHHTAMQQVTG
WQPVGTDSTVISPLPDFVLPLLPEGRGLTPHDKAFRCALGIFTLATIAALLSSGWNNRQQLQRVSFDITR
YDRISMDDYGPKADAVAALREDAALLDDHARNGVPARLSLGLYQGGRLRMPVLEAIRSYVLPPLPPEPQP
KPKPVAKIIRLDSMSLFDSGKYNLKPGSTKMLINSLVGVKARPGWLIVVSGHTDNTGNPQLNQTLSQKRA
EAVRDWMRDTGDVPESCFAVQGYGESRPVATNDTPEGRTLNRRVEISLVPQANACQIPGKYPASSQDDGA
SQHNGE
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3559094-3557604 Klebsiella oxytoca E718 chromosome, complete genome
GTGCTGGTCTGCGGCGATCTGCCGCTGGCCTGGCCGCATCAATCACCGGTACTCATCGTCCCGCAGGGAT
GCTGGATCCGCGTGGAGGATCATCAGGACCTGGAGCAGGTAGCCCGCCAGATACTGTGGCTGCGCCCGGA
CTGGGGGCGTCAGCTGTCGGTAATGGTTTGTGTCTGTCCGCAGCAACACCCGGACAGCGAAGCCCTGACC
AGTCGTCTGATGACCCTGCGCTGGCGCATCAGCCAGCTGCGTAAAGAAACGGGTCATTCTGTGCCACTGA
TTCTGAATGGTCAGGTCGGCAGCGCGATGACGAATGACCTGTTCTGGCAGATGGCTCTCCCGGGTGAAGG
GGTGAGGGTCTGGCGTGAATCTTCAGTTCCGGGCTCTGTCGCTGCATGGGTCACCGCCGGCGGAACGCCT
GCGATGCAGCAGCAGGTGTTGATGAACAGCCTGATGAGCTGGTTCCATCAGCACGTCCAGGCTGTTTTTA
TGGATGAGAACCCCGATGTGCCGGTCATTGCCCCTACCGCAGTGGTGTGGGGCATGAGACCAATCCTTGC
CGGAAGCCTGGCCACATCGGCCTGGACGGCGTGGTTGTCCCATCATACCGCGATGCAACAGGTGACCGGC
TGGCAGCCGGTGGGAACGGACAGTACGGTTATTTCCCCGTTGCCGGATTTTGTCCTGCCATTGCTGCCGG
AAGGGCGAGGCCTGACGCCGCATGACAAAGCCTTCCGCTGTGCGCTCGGGATCTTCACGCTGGCGACTAT
CGCTGCGCTGCTCAGCAGTGGCTGGAACAATCGCCAGCAGCTGCAACGCGTGAGCTTCGATATTACCCGT
TACGACCGCATCTCTATGGATGACTACGGCCCGAAAGCCGACGCCGTTGCGGCCCTGCGCGAGGATGCGG
CATTGCTGGACGACCATGCACGTAACGGTGTACCGGCCCGGCTGAGCCTGGGTTTGTATCAGGGCGGGCG
TCTGCGCATGCCGGTGCTGGAAGCGATCCGCTCGTATGTGCTGCCGCCACTGCCGCCTGAACCACAGCCG
AAACCCAAACCGGTAGCGAAAATTATCCGCCTCGACAGCATGTCGCTGTTCGACTCGGGCAAGTACAACC
TCAAGCCAGGCTCCACCAAAATGCTGATCAATTCACTGGTGGGCGTTAAGGCCAGACCGGGCTGGCTGAT
TGTCGTGTCCGGGCATACCGATAACACCGGCAATCCGCAACTGAACCAGACGCTTTCTCAGAAACGTGCC
GAAGCGGTGCGTGACTGGATGCGTGACACCGGCGACGTGCCGGAAAGCTGTTTTGCGGTGCAGGGCTATG
GCGAAAGCCGTCCTGTCGCAACCAACGACACTCCGGAAGGGCGTACGCTCAACCGCCGTGTCGAAATCAG
TCTGGTACCGCAGGCCAATGCCTGTCAGATACCCGGCAAATACCCGGCGTCATCGCAGGATGATGGCGCA
TCACAACACAATGGAGAGTAA