SecReT6
Protein ID: 397658378
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3377
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3559225..3559914 [-]
Producthypothetical protein
NoteTssL
UniProt IDI6VW88
KEGG IDkoe:A225_3377
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-38, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|397658378|ref|YP_006499080.1| hypothetical protein A225_3377 [Klebsiella oxytoca E718]
MSERKRGGAASIDIDALLQDTWLQVISLRHGPIFQDGEGRTLWERCIADVERVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACVQWYDIPLQGLFLGTMDAGDTLCDRMRDVLREPAPDHAVVTCFQRVMM
LGFLGNFRSLNDPERQKLINALDEYVTPFSYPQTHPVLVESRAGREMGGWLASWPVRIGLSVVVVAALWW
GLDRWLDQMLQTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3559914-3559225 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGTGAGCGTAAACGCGGCGGCGCCGCGTCCATTGATATAGATGCCCTGCTTCAGGATACCTGGCTGC
AGGTGATCAGCCTGCGTCACGGTCCGATATTCCAGGACGGGGAAGGGCGCACGCTTTGGGAACGCTGCAT
TGCTGATGTCGAACGAGTCCAGCGTGAGCTGAAAGCGAGCGAACTTGATGAAGCCAGCTGTCAGCATATT
CTCACGGCACAGTGTGCGCTGCTCGATGAGGCGGTCAAAGGTCGCGGTGTGGAGGACGATGCCTGCGTGC
AGTGGTATGACATTCCCCTGCAGGGGCTCTTCCTTGGCACTATGGACGCGGGTGACACGCTGTGCGATCG
GATGCGCGATGTGCTGCGTGAACCGGCTCCTGACCACGCTGTTGTGACCTGCTTCCAGCGAGTCATGATG
CTGGGTTTCCTCGGCAATTTCCGCTCCCTGAACGACCCTGAACGCCAGAAACTCATTAATGCACTTGATG
AATATGTCACGCCGTTCAGCTATCCACAAACCCATCCAGTCCTGGTGGAAAGCCGCGCCGGACGGGAAAT
GGGCGGCTGGCTGGCATCATGGCCCGTACGTATTGGCCTGAGCGTGGTGGTGGTTGCCGCACTCTGGTGG
GGACTGGATCGCTGGCTGGATCAGATGCTGCAGACCCTGTTGCCGGGAGCGGTGAAATGA