SecReT6
Protein ID: 397658379
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3378
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3559911..3561251 [-]
Producthypothetical protein
NoteTssK
UniProt IDI6X0X7
KEGG IDkoe:A225_3378
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-137, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|397658379|ref|YP_006499081.1| hypothetical protein A225_3378 [Klebsiella oxytoca E718]
MKTEQPLWGRGVMVSPQHFQQQAAYSAWSAECIARLGLSHPWGMIDATFESDALKLGRLQARHLHIRFPD
GTLIDTDNADDLPPVLALENESQHVVVVLALPLLRANGGNCLKPDEVAERPVRYRQRWRDVRNAFGEDTR
QIAVMRPELTLRFAHQNNSDYLTCPIARLQQDSQRAWQLDETFLPPLLAIQGSRWLMTQLEQLMTQLRTR
LSRLMDMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQNPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQHEQLNNVFPPLFDLLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLREGADYYLSV
RSRMSAAQLQEQFPRQCKVGSPDHVRSIVNSSRVGVPLAPLRHVPAAIPLRLENQYFSLDVSHPLTTEML
QSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3561251-3559911 Klebsiella oxytoca E718 chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCGTTATGGTCTCTCCCCAGCACTTCCAGCAGCAGGCCG
CGTATTCAGCCTGGTCTGCGGAATGTATCGCCCGACTCGGGCTTTCTCATCCCTGGGGGATGATCGATGC
CACATTCGAATCGGATGCACTGAAACTGGGCCGCCTGCAGGCCCGTCATCTGCATATCCGTTTCCCCGAT
GGGACATTAATCGATACGGATAACGCTGACGATTTGCCACCGGTACTGGCGCTTGAGAATGAATCACAGC
ACGTGGTGGTGGTACTGGCCCTTCCGCTGCTGCGGGCGAACGGCGGCAACTGCCTGAAACCCGATGAGGT
GGCTGAGCGTCCTGTTCGCTATCGGCAGCGCTGGCGGGATGTCCGCAACGCCTTTGGGGAAGATACCCGC
CAGATTGCGGTGATGCGCCCGGAGCTGACGCTGCGTTTCGCCCATCAGAATAACAGCGATTACCTGACCT
GTCCGATCGCCCGCCTGCAGCAGGATTCGCAGAGGGCGTGGCAACTTGATGAGACGTTTCTTCCCCCGCT
CCTGGCCATCCAGGGTAGCCGCTGGCTGATGACCCAACTGGAGCAACTGATGACCCAGTTGCGTACCCGC
CTGAGCCGCCTGATGGATATGCGCAGGGAAAGCAACGAACGGATGGCGGATTTTGCCGTGGCCGATGTGT
CCCTGTTCTGGTTGCTCAATGCTCTGAACAGCGCTGAGCCCGTGCTCGGACAGTTTCAGCGCCATCCGCA
AAACCCGCCGGAGCGTCTGTATCCGGAGCTGGCCCGTCTGGCGGGCAGCCTGCTGACCTTCTCGCTGGAG
CACCAGGTGAGTGCGATCCCGGTCTGGCAGCATGAGCAACTGAATAACGTTTTCCCGCCGCTGTTTGATT
TACTGGGTGACCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGGTGGCGATTGAACTTGAGCACGATGCCCG
GCTGCACTTCTGGCAGGCCCGTCTGCATGACCCGCGTCTGCGTGAAGGGGCGGATTACTACCTGTCCGTG
CGTTCGCGGATGTCGGCGGCACAGCTGCAGGAGCAGTTCCCGCGCCAGTGCAAGGTCGGCAGTCCCGATC
ATGTCAGAAGTATCGTCAACTCATCGCGGGTGGGCGTACCTCTCGCGCCACTGCGTCATGTACCGGCAGC
CATTCCACTGCGTCTGGAAAACCAGTACTTCAGCCTTGATGTCTCTCACCCCCTGACCACCGAAATGCTC
CAGAGCGGCACATGTATGTTTTACGTTCCGGGAATGCTCGGCGAGCCTGAACTTGAACTCTTTGCGGTAC
TGAGAACATGA