SecReT6
Protein ID: 397658380
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3379
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3561272..3562810 [-]
Producthypothetical protein
NoteTssC
UniProt IDI6WQS6
KEGG IDkoe:A225_3379
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-171, Aligned region: 87..509
Protein Sequence: 512 a.a.     [Download]
>gi|397658380|ref|YP_006499082.1| hypothetical protein A225_3379 [Klebsiella oxytoca E718]
MLMSVNTETAPAQGQTAVLEKESVYASLFDKINLTPASRLGDINDFLDDAALSDAPAGERLTAAMQVFMD
CIRQSGKTVEKLDKTLIDHHIAELDYQISRQLDAVMHHPEFQKVESLWRGLKQLVDSTDYRQNVKTEILD
VSKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALMRNISGVSAAAHMP
FIGAVGPAFFLKESMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLVQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAV
PHFQVEGMDVNLSLVSQMPKAK
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3562810-3561272 Klebsiella oxytoca E718 chromosome, complete genome
ATGCTGATGTCTGTAAATACTGAAACCGCCCCCGCGCAGGGGCAGACCGCTGTACTGGAAAAAGAGAGCG
TTTACGCTTCCCTGTTTGACAAAATCAACCTGACCCCGGCGTCCCGCCTGGGAGATATTAACGACTTTCT
GGATGATGCCGCGCTGTCCGACGCCCCGGCGGGCGAACGACTGACGGCGGCGATGCAGGTGTTTATGGAC
TGCATCCGTCAGTCCGGAAAGACCGTGGAGAAGCTCGACAAGACCCTGATTGACCACCATATCGCTGAAC
TGGATTATCAAATCAGCCGCCAGCTGGACGCGGTGATGCACCATCCTGAGTTCCAGAAGGTGGAATCCCT
GTGGCGCGGGCTGAAGCAGCTGGTGGACAGCACCGACTACCGCCAGAACGTCAAAACCGAAATTCTGGAC
GTCTCCAAAGACGATCTGCGCCAGGACTTCGAAGACGCGCCGGAGCTGATTCAGAGCGGCCTCTACTGGC
ACACCTACACCGCCGAGTACGACACCCCGGGCGGCGAGCCGATTGGCTCGGTGATCTCCGCGTATGAGTT
CGACGCCAGCCCGCAGGACGTGGCGCTGATGCGCAACATCTCCGGCGTCTCCGCCGCGGCCCATATGCCG
TTTATCGGTGCCGTCGGCCCGGCCTTCTTTCTGAAAGAGTCCATGGAAGAGGTTGCCGCCATCAAGGATA
TCGGCAACTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTTCGCGACACCGACGACGCGCGCTA
TATCGGCCTGGTGATGCCGCGCGTGCTGGGCCGCCTGCCGTATGGACCGGACACCGTGCCGGTGCGCAGC
TTCAACTACGTCGAGCAGGTGAAAGGCCCGGACCATGAGAAATACCTGTGGACCAGCGCCTCGTTCTCTT
TCGCGTCCAACATGGTGAAAAGCTTTATTAATAACGGCTGGTGCGTGCAGATCCGTGGCCCGCAGGCGGG
CGGAGCGGTGAAAGATCTGCCGATCCACCTCTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCGTCG
GAGGTGATGATCCCGGAAACCCGCGAGTTTGAGTTCGCCAGCCTCGGCTTTATCCCGCTGTCGTACTACA
AAAACCGCGACTATGCCTGCTTCTTCTCGGCCAACTCCGCCCAGAAGCCGGCGCTGTACGACACCGCCGA
CGCCACCGCCAACAGCCGCATCAACGCGCGCCTGCCGTATATCTTCCTGCTGTCGCGCATTGCGCACTAC
CTGAAGCTCGTTCAGCGTGAAAACATCGGCACCACCAAGGATCGCCGCCTGCTGGAGCTGGAGCTCAACA
CCTGGGTACGCGGTCTGGTGACGGAGATGACCGACCCGGGCGACGAGCTGCAGGCCTCACACCCGCTGCG
CGACGCGAAGGTGGTGGTGGAAGATATCGAGGACAATCCGGGCTTCTTCCGGGTGAAGCTGTACGCGGTG
CCGCACTTCCAGGTGGAAGGGATGGACGTGAACCTGTCTCTGGTTTCTCAGATGCCAAAGGCGAAATAA