SecReT6
Protein ID: 397658381
SecReT6 ID678
T6SS typei2
Gene symbol-
Locus tagA225_3380
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]3562845..3563336 [-]
Producthypothetical protein
NoteTssB
UniProt IDI6WP45
KEGG IDkoe:A225_3380, koe:A225_2626
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|397658381|ref|YP_006499083.1| hypothetical protein A225_3380 [Klebsiella oxytoca E718]
MADTFQNEVPKARINLKLALHTGGAQKKVELPLKLLTIGDFSNGKEDRPLSERAKINVNKNNFNSVLSEF
SPEISLTVQNTLAGDSAEENIQLRFADMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EKILKDPALTQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c3563336-3562845 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAGGTGCCCAAGGCACGCATTAATTTAAAGCTGGCTCTGCACACAGGAG
GCGCGCAGAAGAAAGTCGAGCTGCCGCTGAAACTCCTCACCATCGGTGATTTCAGTAATGGCAAAGAAGA
CCGGCCATTATCGGAAAGAGCAAAAATCAACGTCAATAAAAATAACTTCAACAGCGTACTTTCGGAATTC
AGCCCGGAAATCAGCCTCACGGTACAGAACACGCTGGCCGGCGATAGCGCCGAAGAAAATATTCAGCTCC
GCTTCGCCGATATGAAAGATTTCGAACCGGAGCAGGTGGCCCGCCAGATCCCCCAGCTCCGCGCCATGCT
GGCGATGCGGAATTTATTACGCGACCTCAAATCCAACCTCCTTGATAACGCCACTTTCAGAAAAGAGCTT
GAGAAAATCCTGAAAGACCCGGCGCTGACGCAGGAATTACGCGACGAAATGAGCGCGCTGGCCCCGAAAT
AA