SecReT6
Protein ID: 397659081
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4091
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4308615..4309067 [-]
Producthypothetical protein
NoteTssE
UniProt IDI6VXN5
KEGG IDkoe:A225_4091
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-15, Aligned region: 31..116
Protein Sequence: 150 a.a.     [Download]
>gi|397659081|ref|YP_006499783.1| hypothetical protein A225_4091 [Klebsiella oxytoca E718]
MSESPRPSLYETLYGNFTGGIDLYQVSEQNQTIISVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGMP
GTAHELMGALSAVLLKYEPRLKKIDVVLLEQTIPGELRYAIDAELRGIGLVRYGTAFMPEGRVLIRYLKQ
QQYLDAQTHL
 
Nucleotide Sequence: 453 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4309067-4308615 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGTGAGTCACCCCGTCCGTCACTATATGAAACGCTCTACGGCAATTTTACTGGCGGCATTGATCTGT
ATCAGGTCAGCGAGCAGAACCAGACCATCATTTCTGTGCTGGACAATATGCAGCGTATCCTCAACTGCCG
CGCCGGTACGCTGGCGCACCTGCCGGACTACGGTCTGCCGGATATGACTAAAATCCTGCAGGGGATGCCA
GGGACTGCCCATGAACTGATGGGAGCGTTATCGGCTGTACTGCTGAAGTACGAGCCGCGGCTTAAGAAAA
TTGATGTGGTTCTGCTTGAGCAGACTATTCCGGGGGAATTGCGTTATGCCATTGATGCCGAACTCAGGGG
CATCGGTCTGGTGCGTTACGGCACGGCGTTCATGCCTGAAGGGCGCGTGCTGATACGCTACCTTAAACAG
CAGCAGTATCTTGATGCACAGACCCACCTCTAA