SecReT6
Protein ID: 397659082
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4092
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4309060..4309596 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI6X2P7
KEGG IDkoe:A225_4092
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-38, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|397659082|ref|YP_006499784.1| hypothetical protein A225_4092 [Klebsiella oxytoca E718]
MAIIAGNFPQIALAAGITLILAGCGLTQKVTDGTVAVTKSIFYKQIKTLHLDIRAREAVNSNAGGVALST
VVRIYQLKDRKTFDTTDYPSLFKADSQAIKADLIAEKDIRLQPGGAVMVDMPMEETAQYVAVAGMFMSPD
QENNTWRVVLSRDDLDPDKARVIEAGNNRLTLQALKDE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4309596-4309060 Klebsiella oxytoca E718 chromosome, complete genome
ATGGCGATTATCGCTGGTAATTTTCCTCAGATTGCGCTGGCCGCGGGTATCACACTGATACTCGCTGGCT
GTGGGCTGACGCAAAAAGTGACAGACGGCACCGTTGCCGTGACTAAATCAATTTTTTATAAGCAGATAAA
GACCCTGCATCTGGATATTCGCGCCCGCGAGGCCGTCAACAGCAATGCAGGCGGCGTGGCACTGTCGACG
GTGGTACGTATTTACCAGCTCAAGGACCGAAAAACCTTCGACACGACGGACTACCCGTCACTGTTTAAGG
CTGACAGTCAGGCTATTAAAGCAGACCTGATAGCGGAGAAAGATATTCGTCTGCAGCCGGGTGGGGCGGT
GATGGTGGATATGCCGATGGAGGAAACCGCGCAGTATGTTGCGGTGGCTGGCATGTTTATGTCGCCGGAC
CAGGAGAACAACACCTGGCGGGTGGTGCTGAGCCGCGATGACCTCGATCCGGATAAGGCACGCGTCATCG
AAGCGGGCAACAACCGGCTGACCCTGCAGGCGCTGAAAGATGAGTGA