SecReT6
Protein ID: 397659083
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4093
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4309577..4310671 [-]
Producthypothetical protein
NoteTssG
UniProt IDI6WSE5
KEGG IDkoe:A225_4093
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-81, Aligned region: 22..323
Protein Sequence: 364 a.a.     [Download]
>gi|397659083|ref|YP_006499785.1| hypothetical protein A225_4093 [Klebsiella oxytoca E718]
MERESQSAPARLMERLGDRLPYINFYRFCQLLEQSQPDKPVTGSTWQVRHEPVRFRPHPGMGFPASEIRS
FDAAEYPHLPPTVRITFMGLYGVESPLPTHYIDDITQRREGYEATADFLDIFNHRLIAQYYRIWRKYSYP
ATFEEGGKDKTSQYLLGLAGLGIDGCTDSIAAPASRFLALLPVMMLPGRTAEGMASLVRLLAPGTQVKIW
HHDKRRVPLKKPLTMSVSQPVTLTNRPVMGNYATDVNSQVLMRLTTTDPAEVPGWLPGGELHTDLMALLH
VYLGSRLDVRLQLCVDRCLLPDATMSTKPKAGAVQLGRTAVMRPLNATNTVVHPQIININLGRYERVQEN
IHRRETDEDGDYRW
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4310671-4309577 Klebsiella oxytoca E718 chromosome, complete genome
GTGGAAAGAGAATCACAGTCCGCGCCTGCCAGGCTGATGGAGCGGCTGGGTGACCGGCTGCCATATATCA
ATTTTTACCGCTTCTGTCAGTTGCTGGAGCAGAGCCAGCCGGACAAACCGGTTACGGGCAGCACCTGGCA
GGTACGTCATGAGCCGGTACGTTTTAGGCCGCACCCGGGGATGGGCTTCCCGGCTTCAGAAATCAGGTCA
TTCGACGCTGCTGAGTACCCGCATCTTCCGCCGACGGTACGTATCACCTTTATGGGGCTTTATGGCGTGG
AGTCTCCGCTGCCGACGCACTATATCGATGATATCACCCAGCGGCGGGAAGGGTACGAAGCCACGGCGGA
TTTCCTCGATATCTTCAATCACCGGCTGATTGCCCAGTACTACCGCATCTGGCGGAAATATTCGTATCCG
GCAACTTTTGAGGAAGGCGGTAAGGACAAAACTTCGCAGTACCTGCTGGGGCTGGCCGGGCTCGGGATTG
ACGGCTGTACAGACAGTATCGCCGCGCCAGCCTCACGCTTTCTGGCGCTGCTGCCGGTCATGATGCTGCC
GGGGAGGACTGCAGAAGGCATGGCCTCACTGGTGCGTCTGCTGGCACCCGGCACGCAGGTAAAAATCTGG
CACCACGACAAACGCCGCGTGCCGCTGAAGAAGCCCCTGACCATGAGCGTCAGCCAGCCCGTCACCCTGA
CAAACCGTCCGGTGATGGGTAACTATGCCACCGATGTGAATAGTCAGGTACTGATGCGTCTGACCACCAC
TGACCCGGCTGAAGTGCCGGGCTGGCTACCGGGCGGGGAGCTTCACACGGATTTAATGGCTCTGCTGCAT
GTGTATCTTGGCTCACGGCTCGATGTGCGCCTGCAGTTATGTGTCGACCGTTGCCTGCTGCCGGATGCGA
CGATGAGTACTAAACCCAAAGCTGGTGCAGTGCAGCTGGGCCGCACCGCCGTGATGCGGCCGCTGAATGC
GACGAATACCGTCGTACACCCTCAAATTATAAACATCAATCTTGGCCGCTATGAGCGGGTCCAGGAAAAT
ATTCACCGCAGGGAGACCGATGAAGATGGCGATTATCGCTGGTAA