SecReT6
Protein ID: 397659084
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4094
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4310635..4312398 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDI6W8B4
KEGG IDkoe:A225_4094
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-182, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|397659084|ref|YP_006499786.1| protein ImpG/VasA [Klebsiella oxytoca E718]
MKDQTLRYFDAEMRYLREAAKEFAQTHPDRAAMLDLDKAGTPDPYVERLFEGFAFSMGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSVVALTPALHAMKMAEVVPAGLEVYSRPVGPKNTVCRYRTTQDVMLNPLS
VSAVTMTTEPDGRSLLRMRMACSSQADWSHADLSRLSLYLGADAPVSSQLHLMLTKRQAALYMRLPGQTD
RIRLDGYFSPGGFAEEDGLWPKGDTAFSGYQLLLEYFTFRDKFMFVHFNGLDGITPPAGTEYFDIEVVFS
TPWPSDLPVTDDAVRLHCVPVINLFTLEADPLTITGLESEYLLRPKRLQDGHTEIYSVDSVTGSNRTNDA
EYVPFSSFRHKGGMMRRQAPPRYYHTRVKRSVTGLYDTWLILGGHQWEDDRLLDREAVSLQITGTNGQLP
RRALQSTLLDSCEQVVSTPLSVRNLCKPTLPVYPPAEDRFHWRVLSHLGSGFLNMLSTAEVLRGTLALYN
WQEDELNTRRLEAIQHVEHHRLQRFEQGYLLRGLDIEVILDSNGFTGEGDIHLFGEMLNRFFALYVDMNQ
FNQLTLIVQPEGKCIRWKENHSPRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4312398-4310635 Klebsiella oxytoca E718 chromosome, complete genome
ATGAAAGATCAGACCCTGCGCTATTTTGATGCAGAAATGCGCTACCTGCGTGAAGCCGCAAAAGAGTTCG
CGCAAACCCATCCCGATCGTGCAGCGATGCTCGACCTGGATAAAGCTGGTACACCGGATCCGTATGTCGA
ACGCCTGTTTGAAGGCTTTGCTTTCTCGATGGGACGGCTGCGCGAAAAGATTGACGACGACCTGCCGGAA
CTCACCGAAGGGCTGGTCAGTATGCTCTGGCCGCATTACCTGCGTACCATTCCGTCGCTTTCGGTGGTGG
CACTTACCCCAGCGCTGCATGCCATGAAAATGGCCGAAGTCGTGCCCGCGGGGTTGGAGGTGTACTCCCG
CCCGGTGGGGCCGAAGAACACGGTCTGTCGTTACCGTACGACCCAGGATGTAATGCTCAATCCCCTGAGT
GTCTCAGCGGTCACCATGACCACCGAACCTGACGGACGTTCGCTGTTGCGGATGCGCATGGCCTGCAGTA
GTCAGGCGGACTGGTCGCATGCCGACCTCAGCCGCCTGAGCCTCTATCTCGGCGCAGATGCACCCGTCAG
CAGTCAGCTGCACCTGATGCTCACGAAACGACAGGCTGCCCTGTATATGCGTCTGCCCGGGCAGACCGAT
CGTATTCGGCTTGACGGGTACTTCTCGCCGGGAGGATTTGCGGAGGAAGACGGGCTGTGGCCGAAGGGGG
ATACCGCCTTCAGCGGCTACCAGTTGTTGCTGGAGTACTTCACCTTCCGCGACAAGTTTATGTTTGTCCA
CTTTAATGGCCTGGACGGCATCACGCCGCCTGCCGGGACAGAGTACTTCGACATTGAAGTGGTATTCAGC
ACGCCGTGGCCGTCTGATCTGCCGGTCACCGATGACGCGGTTCGACTGCACTGCGTGCCGGTGATTAATC
TGTTCACCCTGGAGGCGGACCCGCTCACCATTACGGGCCTGGAAAGTGAGTACCTGCTGCGCCCCAAACG
GCTGCAGGACGGACACACCGAGATTTACTCCGTGGATTCGGTCACCGGCTCAAACCGGACGAACGACGCG
GAGTATGTGCCGTTCAGCTCCTTCCGCCATAAAGGCGGGATGATGCGCCGCCAGGCACCACCGCGTTACT
ACCATACCCGCGTGAAGCGCAGTGTGACCGGGCTGTATGACACCTGGCTTATCCTCGGCGGTCACCAGTG
GGAAGATGACCGCCTCCTTGACCGCGAAGCCGTGTCGCTACAAATCACCGGCACCAACGGTCAGTTACCA
CGCCGGGCATTGCAGAGCACGCTGCTGGATAGCTGTGAGCAGGTGGTCAGTACACCGCTTTCAGTACGCA
ACCTCTGCAAACCGACGCTGCCGGTCTACCCGCCTGCGGAAGACCGATTCCACTGGCGGGTGCTGAGCCA
CCTGGGCTCCGGATTCCTGAATATGCTGAGTACCGCTGAAGTGCTGCGCGGGACGCTTGCGCTCTATAAC
TGGCAGGAAGATGAACTGAACACCCGGCGTCTGGAGGCTATTCAGCATGTGGAGCATCACCGCCTTCAGC
GCTTTGAGCAGGGCTACCTGCTACGGGGCCTGGATATCGAAGTGATCCTCGACAGCAATGGTTTTACCGG
TGAGGGCGATATTCATCTGTTTGGTGAAATGCTTAACCGGTTTTTTGCGTTGTATGTCGATATGAACCAG
TTCAACCAGCTTACCCTCATCGTTCAGCCAGAAGGAAAATGCATCCGGTGGAAAGAGAATCACAGTCCGC
GCCTGCCAGGCTGA