SecReT6
Protein ID: 397659087
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4097
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4313405..4313767 [-]
Producthypothetical protein
NoteTssA
UniProt IDI6X2Q2
KEGG IDkoe:A225_4097
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-19, Aligned region: 66..119
Protein Sequence: 120 a.a.     [Download]
>gi|397659087|ref|YP_006499789.1| hypothetical protein A225_4097 [Klebsiella oxytoca E718]
MSMLNTLLSACQTEQEPLLVATRERVAQWDSWLQPLSGQSAAGEDPGYDDDFQQMREEVNKLSGADTELI
CRLAEKLLTTTAKDIRVATYYCRAKLHREGEQGLAEGLELLAGLLERFGP
 
Nucleotide Sequence: 363 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4313767-4313405 Klebsiella oxytoca E718 chromosome, complete genome
ATGAGCATGCTGAATACATTACTGAGCGCCTGCCAGACAGAACAGGAACCATTACTTGTAGCAACCCGTG
AGCGAGTGGCGCAGTGGGACAGCTGGCTGCAGCCGCTGTCCGGGCAATCGGCCGCTGGCGAAGACCCGGG
CTATGACGATGACTTTCAGCAGATGCGCGAGGAGGTCAACAAACTTTCCGGTGCGGATACAGAACTCATC
TGCCGGCTGGCAGAGAAGCTGCTGACCACGACCGCGAAAGACATTCGCGTCGCGACGTACTACTGCCGGG
CGAAGCTGCACCGCGAAGGTGAACAGGGACTGGCTGAAGGACTTGAACTGCTGGCCGGTCTGCTGGAGCG
CTTTGGTCCATAG