SecReT6
Protein ID: 397659091
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4101
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4321755..4324370 [-]
ProductVgrG protein
NoteTssI
UniProt IDI6VXP2
KEGG IDkoe:A225_4101
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.80E-58, Aligned region: 35..356
DUF2345 [PF10106], Evalue: 6.90E-47, Aligned region: 609..760
T6SS_Vgr [PF13296], Evalue: 2.60E-31, Aligned region: 488..594
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 401..481
Sarcoglycan_1 [PF04790], Evalue: 0.002, Aligned region: 680..730
Protein Sequence: 871 a.a.     [Download]
>gi|397659091|ref|YP_006499793.1| VgrG protein [Klebsiella oxytoca E718]
MENIFKMTGGVLNRYKLDIPSCPYPLDVERFDGLEQMSALYHYTIRFTSSHPELTAEMMLSKTATLSIGV
GELFNSTVGKIVHGVVTNFRRLIGSRDQVTYEIILEPFISLLDKQFRTHRFFVNKSVPEVVAQILGEHGL
KGWEYEFKLKQTYPKREQINQYQESDLEFIERLLAEVGIFYFFTLQPDTQTEVVHFADKQSAWTFGKKLP
LNSPSGENDNAADSVWGVQVWHNVVERSVTASDYNHREAQSVLMSVPADMTRGDGEGNTYGDVYHYRPRH
LERGDKITPPAETGNFWARLEHERFLSTQTTVTGSSTDHTLGPAQVLTITEMAIPPTLPRETENGVVIIR
TGYYASRKNALKVAWVAIPYYENRCWRPAAKKRPVVSGTLTARVTSAKDNDIYAWQDASGMYRVKFDADR
DDKRQGMESMPVRFAKPYGGDKYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDHVTEANSTRN
VIRTAGLNKLRMEDKRGEEHIKLSTEFGGKTQLNLGHNVDASRELRGEGAELRTDRHVSIRGGAGVFITA
DKQPFAGDKMLSMQEAIAQLENALSIARSMSDAAETAQALPADIQSQVKLTDALKDLVQPGMVLNAPEGV
SITSPQAVRMASGSASVGIMSQQNTDISALKRFTVAAGEAVSMLARKAGMKLFAAKGKVEIQAQDDALDA
IAKKDVTVTSTEGRVEITAAKDVVLKNLDGSFIQLQGKNIILGCEGNILWKCANAQKMGSVSMSSVMPQF
PSGYSGKFTASSDAGVPVAAAAYMLTSSNGQKLFGRTDENGETVPVYSSNPNEPFEVEMIQSDYWYDSEN
IVERVHCSSFSDMSFQDDGCQCSDCEGNKSA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4324370-4321755 Klebsiella oxytoca E718 chromosome, complete genome
ATGGAAAATATATTTAAAATGACAGGGGGGGTCCTTAATCGCTATAAACTAGATATTCCTTCCTGCCCTT
ATCCATTGGATGTGGAACGTTTTGATGGTTTAGAACAAATGAGTGCTCTATATCATTACACCATTCGTTT
TACCAGTTCACATCCGGAGCTTACGGCTGAAATGATGTTAAGTAAAACCGCTACGCTGAGCATAGGGGTG
GGAGAACTATTTAATTCTACTGTCGGTAAAATTGTTCATGGCGTGGTGACAAATTTCCGACGCCTGATCG
GTTCACGCGATCAGGTTACGTATGAAATTATTCTGGAACCCTTTATATCCTTACTGGATAAGCAGTTTCG
TACTCACCGTTTCTTCGTCAACAAATCAGTGCCGGAAGTGGTAGCGCAAATTCTTGGCGAGCATGGTTTG
AAAGGGTGGGAATATGAATTCAAGCTTAAACAAACCTACCCAAAACGGGAACAGATAAACCAGTACCAGG
AAAGTGACCTTGAGTTTATTGAACGCCTGCTGGCAGAGGTGGGGATTTTTTACTTCTTCACCCTGCAGCC
TGACACTCAGACCGAAGTGGTGCACTTCGCGGACAAGCAGAGTGCCTGGACGTTTGGTAAGAAACTGCCG
CTGAACAGCCCGTCAGGGGAGAATGACAATGCGGCCGACTCGGTGTGGGGCGTACAAGTCTGGCATAACG
TGGTGGAGCGTTCGGTCACCGCCAGTGACTACAACCACCGCGAAGCCCAGAGCGTCCTGATGTCCGTACC
GGCTGACATGACCCGCGGCGACGGCGAGGGGAACACCTACGGTGATGTGTACCATTATCGCCCGCGTCAC
CTTGAACGTGGCGACAAAATTACACCGCCGGCAGAAACCGGTAACTTCTGGGCGCGTCTGGAGCATGAAC
GCTTCCTGTCCACCCAGACCACGGTGACCGGCAGCAGCACCGACCACACCCTTGGACCGGCGCAGGTACT
GACTATTACCGAAATGGCTATCCCGCCAACACTGCCCCGTGAAACGGAGAACGGTGTTGTTATTATCCGC
ACTGGCTACTACGCCAGCCGTAAGAATGCCCTAAAAGTGGCATGGGTAGCGATACCCTACTACGAAAACC
GTTGCTGGCGCCCTGCGGCTAAAAAGCGCCCGGTGGTCAGCGGCACCCTGACGGCACGAGTGACCAGCGC
CAAAGATAACGATATCTACGCCTGGCAGGATGCCTCGGGCATGTATCGGGTGAAATTTGATGCTGACCGC
GATGACAAGCGTCAGGGCATGGAAAGTATGCCGGTGCGTTTTGCCAAACCTTACGGCGGAGACAAATACG
GCTTCCACTTCCCGCTGATACAGGGCACGGAAGTTGCTATTGCATTCCACGAAGGCGATCCGGATCGCCC
GTATATAGCTCACGCCCTGCATGACTCCCGTCACGTCGATCACGTCACTGAAGCCAACAGCACGCGCAAT
GTCATCCGTACCGCTGGCCTGAACAAGCTGCGGATGGAGGACAAGCGCGGCGAAGAGCACATCAAGCTCA
GTACAGAGTTCGGGGGCAAGACGCAGCTCAATTTAGGTCACAATGTAGACGCTTCCAGGGAGCTTCGTGG
TGAAGGGGCAGAACTGCGCACCGACCGGCATGTTTCCATTCGCGGTGGTGCTGGTGTGTTTATCACTGCA
GATAAACAACCGTTTGCCGGGGACAAGATGCTTTCCATGCAGGAGGCGATAGCCCAGCTTGAGAATGCAC
TGAGTATTGCCCGCAGCATGTCAGACGCAGCTGAAACCGCGCAGGCGCTACCCGCTGATATTCAGAGTCA
GGTGAAGTTGACTGATGCCCTCAAAGATCTGGTGCAGCCAGGAATGGTGTTGAATGCACCTGAAGGCGTG
AGCATCACCAGCCCACAGGCGGTTCGCATGGCGTCAGGTAGTGCCAGCGTTGGGATCATGTCGCAACAGA
ATACAGACATTAGCGCACTTAAACGATTTACCGTAGCAGCAGGTGAAGCCGTGAGTATGCTGGCCCGAAA
GGCCGGAATGAAACTTTTTGCTGCTAAGGGAAAAGTAGAAATTCAGGCTCAGGATGATGCGCTTGATGCG
ATAGCCAAAAAGGATGTGACCGTAACCAGTACAGAAGGGCGGGTTGAGATCACGGCGGCGAAAGATGTTG
TGCTTAAAAATTTGGATGGGTCGTTCATCCAGTTGCAGGGTAAGAATATTATTCTGGGCTGTGAAGGTAA
TATCCTGTGGAAATGTGCCAATGCGCAGAAAATGGGTAGTGTAAGCATGAGTAGTGTTATGCCCCAGTTT
CCATCTGGATATAGTGGGAAATTTACGGCATCGTCTGATGCAGGAGTTCCAGTTGCCGCTGCGGCATACA
TGTTGACATCGAGTAATGGGCAGAAATTATTTGGTAGAACAGACGAGAACGGTGAAACAGTTCCAGTTTA
CTCATCAAACCCGAATGAGCCTTTTGAAGTTGAAATGATTCAAAGTGATTATTGGTACGATAGTGAAAAT
ATTGTGGAAAGAGTACATTGTTCATCATTTTCAGATATGTCATTCCAGGACGATGGTTGCCAATGCAGTG
ATTGTGAGGGAAATAAAAGTGCGTGA