SecReT6
Protein ID: 397659094
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4104
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4326534..4327637 [-]
ProductclpB protein
NoteTssH
UniProt IDI6W8C4
KEGG IDkoe:A225_4104
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 5.00E-09, Aligned region: 220..332
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 118..118
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 197..241
AAA_16 [PF13191], Evalue: 4.20E-07, Aligned region: 270..298
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 198..235
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 272..363
NACHT [PF05729], Evalue: 0.00024, Aligned region: 220..249
AAA_22 [PF13401], Evalue: 0.00034, Aligned region: 43..77
AAA_22 [PF13401], Evalue: 0.00034, Aligned region: 219..305
Clp_N [PF02861], Evalue: 0.0014, Aligned region: 4..47
Clp_N [PF02861], Evalue: 0.0014, Aligned region: 86..104
AAA_25 [PF13481], Evalue: 0.0028, Aligned region: 220..244
AAA_5 [PF07728], Evalue: 0.0028, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 0.0028, Aligned region: 303..350
Protein Sequence: 367 a.a.     [Download]
>gi|397659094|ref|YP_006499796.1| clpB protein [Klebsiella oxytoca E718]
MEVAASLCQTRAHAEILPEHWLLKLLELGEGDLTVLARRYEWDMDAIWQDLLAFLDTLPRSVRSRPQLSD
SIQTLMQDAWLHASLAGEEHIRSIHLLMALVDKPKLAHCDGLWPLLTLGQGQLERLRPLLDAQSDERPEV
QQEAELAQNHGGEVEFVGSQVGAGIKEGELTPALQNALDKFTIDVTAKAKEGKIDPVFGRDTEIRQMVDI
LSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKPVVLRTLDLGLLQAGTGVKGEFEQRLKNVI
DAVQKSLVPVPLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRF
QMVKVDEPDDETACMTR
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4327637-4326534 Klebsiella oxytoca E718 chromosome, complete genome
ATGGAAGTGGCAGCTTCGCTCTGCCAGACCCGCGCTCACGCGGAAATCCTGCCTGAGCACTGGCTGCTGA
AGCTGCTGGAGCTGGGAGAGGGGGACCTGACGGTGCTGGCACGGCGCTACGAATGGGATATGGACGCCAT
CTGGCAGGATTTGCTGGCATTTCTCGACACGCTGCCCCGTTCGGTGCGCAGCCGTCCGCAGCTCTCAGAC
AGTATTCAGACCCTGATGCAGGACGCCTGGCTGCATGCCTCGCTGGCGGGTGAAGAGCACATCCGCAGCA
TTCACCTGCTGATGGCGCTGGTCGATAAACCTAAACTGGCACACTGCGATGGACTGTGGCCGCTGCTGAC
CCTCGGGCAGGGCCAACTTGAGCGTCTTCGCCCGTTGCTGGATGCACAGTCAGATGAGCGCCCGGAAGTG
CAGCAGGAAGCCGAACTGGCACAAAATCACGGTGGTGAAGTGGAATTTGTCGGCAGTCAGGTCGGCGCGG
GGATAAAAGAAGGCGAGCTGACTCCGGCCCTGCAGAACGCACTGGATAAATTTACCATTGATGTCACCGC
CAAAGCGAAAGAGGGCAAGATTGATCCGGTCTTTGGGCGCGATACGGAAATCCGCCAGATGGTGGACATT
CTCTCGCGCCGCCGCAAGAACAACCCGATCCTGGTCGGTGAGCCGGGCGTGGGGAAGACCGCCCTGGTGG
AAGGGCTGGCGCTGCGTATTGCCGAAGGCAACGTACCGGAATCCCTCAAGCCTGTAGTTCTACGTACTCT
CGACCTGGGCCTGCTTCAGGCGGGGACTGGTGTAAAGGGGGAGTTCGAGCAGCGCCTGAAAAACGTCATC
GATGCCGTACAGAAGTCACTGGTACCGGTTCCGCTGTTTATCGACGAAGCCCACACCATTATCGGTGCCG
GCAACCAGGCCGGCGGGGCGGATGCGGCCAATCTGCTGAAACCGGCTCTGGCGCGTGGCGAACTGCGCAC
CATCGCGGCCACCACCTGGAGCGAATATAAGCAATATTTTGAACGAGATGCCGCACTGGAGCGCCGCTTC
CAGATGGTCAAAGTGGACGAACCGGATGATGAAACGGCCTGCATGACGCGCTGA