SecReT6
Protein ID: 397659097
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4107
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4330202..4330855 [-]
Producttransmembrane protein
NoteTssL
UniProt IDI6X2R2
KEGG IDkoe:A225_4107
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-44, Aligned region: 9..206
Imm29 [PF15575], Evalue: 0.00095, Aligned region: 66..196
Protein Sequence: 217 a.a.     [Download]
>gi|397659097|ref|YP_006499799.1| transmembrane protein [Klebsiella oxytoca E718]
MNTSEMSQIERIFYPGWLMASQLRGGQEVRDGEGLYRRACRLVQEAKAALTEAGYSDISRDHMVYALCAL
LDESVMNRGTTDDGYLTWHRDPLQAHFFGTLNAGEELWERIRDLLKDTTPDAAVLTCMYRTLQLGFVGQY
RAQDDERREDTVRALAERVPAFTLAQDAPIVARASRLRSGRRGYWLTWVVAVVALAALWFFLSSSLTGLV
SQTVRPG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4330855-4330202 Klebsiella oxytoca E718 chromosome, complete genome
ATGAATACATCAGAAATGAGTCAAATTGAGCGTATTTTCTACCCGGGCTGGCTGATGGCCAGCCAGCTGC
GGGGCGGACAGGAGGTCCGTGACGGGGAAGGGCTCTATCGTCGGGCCTGCCGTCTGGTGCAGGAGGCGAA
GGCTGCGCTCACAGAAGCCGGTTACAGCGACATCAGCCGTGACCATATGGTGTATGCCCTGTGTGCACTG
CTTGATGAGAGCGTGATGAACCGGGGTACAACCGATGATGGCTATCTGACCTGGCACCGTGACCCGCTAC
AGGCACACTTCTTTGGTACCCTCAATGCCGGTGAGGAGCTGTGGGAAAGGATCCGAGATCTGCTGAAAGA
TACTACCCCTGACGCCGCCGTCCTGACCTGTATGTACCGGACCCTGCAGCTGGGGTTTGTGGGTCAGTAT
CGCGCCCAGGATGATGAGCGTCGGGAAGATACTGTTCGCGCGCTTGCAGAACGGGTGCCGGCCTTCACGC
TGGCACAGGACGCCCCGATTGTGGCCCGGGCATCACGCCTGCGCAGCGGTCGTCGCGGGTACTGGCTGAC
CTGGGTTGTGGCCGTTGTCGCCCTGGCCGCGCTCTGGTTCTTCCTCTCGTCTTCGCTTACCGGGCTGGTA
AGCCAGACCGTCAGGCCGGGGTAA