SecReT6
Protein ID: 397659098
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4108
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4330852..4332189 [-]
Producthypothetical protein
NoteTssK
UniProt IDI6WSF5
KEGG IDkoe:A225_4108
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.20E-129, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|397659098|ref|YP_006499800.1| hypothetical protein A225_4108 [Klebsiella oxytoca E718]
MKIYRPLWEDGAALAPQQFQQQARWSEYVADMVARMGFSHPWGVVAAEFDDAALALARLNAIRLVVRFQD
GTMVDTDLADNIPPVCDLYAANGSEAVEVVAALPLLSASGGNLDNGQDSERPRRWKAERVVVQELAGHES
GELAILRHALTLRLSSQENTAYLTCPVARLVRNAQGQWSRDPSFIPPMLSVAASPWLATELGDLLVRLQA
RRRRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLTELLQTPDRHPELLYRELSRLAGSLLTFSL
EHDAGDLPAYQHDAPERVFPPLLALLDKLLEASLPSRVVSIHLEHQDQIWKGALHDARLREGADFYLSVR
SSMPNYELQTKFPQLCKAGSFDDVSDVVNVALSGMVIKPLTHVPAAIPLRLENQYFSLDLSSEAARAMLE
AGSCTFYTPRSLGDVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4332189-4330852 Klebsiella oxytoca E718 chromosome, complete genome
ATGAAAATTTACCGCCCACTTTGGGAGGATGGGGCCGCTCTGGCCCCGCAACAATTCCAGCAGCAGGCCC
GCTGGAGTGAATACGTTGCCGACATGGTCGCCCGGATGGGGTTTTCTCATCCCTGGGGCGTGGTTGCGGC
AGAATTTGATGATGCTGCACTGGCGCTCGCGCGCCTGAATGCCATCCGTCTGGTCGTACGTTTCCAGGAT
GGCACGATGGTTGATACGGATCTGGCGGATAATATTCCGCCGGTCTGTGATTTGTATGCCGCAAACGGCT
CTGAGGCTGTTGAGGTGGTTGCCGCATTGCCGCTGCTGAGCGCCAGTGGTGGCAACCTTGATAACGGACA
AGACAGCGAGCGCCCGCGTCGCTGGAAAGCTGAGCGTGTGGTGGTGCAGGAACTGGCCGGCCATGAAAGC
GGGGAACTCGCGATCTTGCGTCATGCGCTGACCCTGCGTCTGTCCAGCCAGGAAAACACGGCATACCTGA
CCTGTCCGGTCGCTCGTCTGGTGCGTAATGCGCAGGGGCAGTGGAGCCGGGACCCGTCCTTTATCCCGCC
AATGCTGTCTGTTGCTGCCAGTCCGTGGCTTGCCACCGAACTGGGTGACCTGCTGGTCCGTCTGCAGGCC
CGCCGCCGTCGCCTGATGGCCATGCGTCGTGAGAGCAATGAGCGGATGGCAGACTTTGCGGTCGCGGATG
TCTCCCTGTTCTGGCTGCTTAATGCCCTGAACAGCGCCGAGCCGGTGCTGACGGAACTGCTGCAGACACC
GGATCGTCATCCGGAACTGTTGTACCGCGAATTGTCCCGTCTGGCCGGCAGCCTGCTCACCTTCTCTCTG
GAACACGACGCCGGCGATCTTCCTGCTTACCAGCACGATGCACCGGAACGGGTATTTCCGCCGCTGCTGG
CACTGCTCGATAAGCTGCTGGAAGCGAGCCTGCCGTCACGGGTGGTGAGTATCCACCTGGAGCACCAGGA
CCAGATCTGGAAAGGTGCCCTGCACGATGCGCGCCTGCGCGAAGGGGCGGACTTCTACCTTTCCGTACGC
TCCTCCATGCCGAATTATGAACTTCAGACGAAATTCCCGCAGCTGTGTAAAGCGGGCAGCTTTGATGATG
TTTCGGATGTGGTGAATGTGGCCCTGAGCGGGATGGTTATCAAGCCGCTGACCCATGTGCCGGCCGCTAT
CCCGTTACGTCTTGAGAACCAGTATTTCTCGCTGGATCTGAGTAGTGAGGCGGCGCGGGCGATGCTGGAA
GCGGGAAGTTGCACCTTCTATACCCCGCGCTCACTGGGGGATGTGAAACTTGAACTCTTTGCGGTGCTGC
GCACATGA