SecReT6
Protein ID: 397659099
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4109
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4332208..4333758 [-]
Producthypothetical protein
NoteTssC
UniProt IDI6W8C9
KEGG IDkoe:A225_4109
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-172, Aligned region: 91..512
Protein Sequence: 516 a.a.     [Download]
>gi|397659099|ref|YP_006499801.1| hypothetical protein A225_4109 [Klebsiella oxytoca E718]
MLMSVNNESQNYTGGATIEKTLPQNGVYASLFNKINLTPVAEIGDLNGFEDNTVMAETSADARVTAAVQV
FMQCLQKSGQKVEKLDKTLLDHHIAELDFQISRQLDKVMHSDEFQKTESVWRGLKSLVDKTDFRQNVKIE
ILDLSKDELRQDFEDSPEIIQSGLYRQTYTMEYDTPGGEPIAAVISAYEFDASAQDVALMRNISKVSAAA
HMPFIGSAGPAFFLKENMEQVAAIKDIGNYFDRAEYIKWKSFRETDDSRYLGLVMPRVLGRLPYGPDTVP
VRSFNYVEEVKGPDHDKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGKQVK
IPSEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRI
AHYLKLIQRENIGSTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKL
YAIPHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4333758-4332208 Klebsiella oxytoca E718 chromosome, complete genome
ATGCTTATGTCAGTCAATAATGAATCCCAGAATTATACAGGCGGTGCGACAATTGAAAAGACGCTGCCAC
AGAATGGTGTTTATGCTTCCCTGTTCAATAAAATTAATTTAACACCGGTTGCTGAAATTGGTGACCTGAA
TGGTTTTGAAGATAATACCGTGATGGCGGAAACATCTGCTGATGCGCGCGTTACTGCCGCCGTTCAGGTC
TTCATGCAGTGCCTACAGAAGTCTGGCCAGAAAGTTGAGAAACTCGATAAAACATTACTGGATCACCACA
TCGCAGAACTGGATTTCCAGATTAGCCGCCAGCTTGATAAAGTGATGCACAGCGATGAATTCCAGAAGAC
AGAATCCGTCTGGCGCGGCCTGAAATCGCTGGTTGATAAGACTGATTTTCGTCAGAACGTAAAAATCGAG
ATTCTTGACCTGTCCAAAGATGAACTGCGTCAGGATTTCGAGGACTCGCCGGAAATTATCCAGAGTGGCC
TGTACCGCCAGACATACACGATGGAATACGACACGCCGGGTGGCGAGCCGATTGCTGCGGTGATTTCAGC
GTACGAGTTTGATGCGTCCGCGCAGGACGTGGCGCTGATGCGCAATATTTCAAAAGTGTCTGCGGCAGCC
CACATGCCGTTCATTGGCTCTGCAGGCCCGGCGTTCTTTTTAAAAGAGAACATGGAGCAGGTTGCCGCTA
TCAAGGACATCGGTAATTACTTCGACCGCGCCGAGTACATCAAATGGAAATCCTTCCGCGAGACGGACGA
TTCCCGCTATCTCGGTCTGGTGATGCCGCGCGTGCTGGGACGCCTGCCGTATGGCCCGGATACCGTACCG
GTGCGCAGTTTCAACTACGTTGAAGAAGTGAAAGGCCCGGATCACGATAAATACCTGTGGACCAACGCCT
CGTTCGCCTTTGCGGCCAACATGGTGAAGAGCTTCATCAACAACGGCTGGTGCGTGCAAATCCGTGGCCC
GCAGGCCGGTGGTGCCGTCCAGGACCTGCCAATCCATCTGTATGACCTCGGCACCGGCAAACAGGTGAAG
ATTCCGTCAGAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAGCCTCGGCTTCATTCCCCTGT
CGTACTACAAGAACCGCGACTATGCGTGCTTCTTCTCGGCGAACTCCACCCAGAAACCGGCGCTGTACGA
CACCGCCGATGCGACGGCCAACAGCCGCATTAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGCATC
GCCCACTATCTGAAGCTGATTCAGCGCGAGAACATCGGTTCCACCAAGGACCGCCGCCTGCTGGAGCTGG
AACTCAACACCTGGGTGCGCAGTCTGGTGACCGAAATGACCGATCCGGGCGACGAGCTGCAGGCCTCACA
CCCACTGCGCGACGCAAAAGTGGTGGTGGAAGACATCGAAGACAATCCGGGCTTCTTCCGCGTGAAGCTG
TACGCTATCCCGCACTTCCAGGTGGAAGGCATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAAG
CCAAATCGTAA