SecReT6
Protein ID: 397659100
SecReT6 ID679
T6SS typei2
Gene symbol-
Locus tagA225_4110
StrainKlebsiella oxytoca E718
Repliconchromosome [GenBank: NC_018106] [Browse all T6SS(s) in this replicon]
Location [Strand]4333795..4334292 [-]
Producthypothetical protein
NoteTssB
UniProt IDI6X610
KEGG IDkoe:A225_4110
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-51, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|397659100|ref|YP_006499802.1| hypothetical protein A225_4110 [Klebsiella oxytoca E718]
MSESFQNEIPRARVNIKLDLVTGGARKKVELPLKLLTVGDYSNGRAEGTLSEREKININKNNFNSVLADL
HPEVNITVKNTLANDGSEENVKLLFQNMKDFEPEAVARQIPQLRAMLAMRNLLRDLKSNLLDNVTFRKEL
ETILKDPALTDELRRELNALAPVQG
 
Nucleotide Sequence: 498 bp     [Download]
>gi|397655102|ref|NC_018106.1|:c4334292-4333795 Klebsiella oxytoca E718 chromosome, complete genome
ATGTCTGAATCATTTCAGAACGAGATACCCCGCGCGCGCGTAAATATAAAACTGGATCTGGTCACGGGCG
GTGCCAGGAAGAAAGTTGAACTGCCGCTGAAGCTGCTGACTGTCGGCGATTACAGCAATGGCAGGGCGGA
GGGGACCCTTTCAGAGCGCGAAAAAATCAACATCAATAAAAATAACTTCAACAGCGTTCTCGCTGATCTC
CATCCCGAAGTAAATATCACCGTTAAAAATACCCTGGCAAACGATGGCTCCGAAGAAAACGTGAAGCTGC
TTTTTCAGAATATGAAGGATTTTGAGCCAGAGGCGGTGGCACGTCAAATACCTCAGCTCCGTGCGATGCT
CGCTATGCGTAATTTACTGCGTGATTTGAAATCCAATCTTCTGGATAATGTCACTTTCAGGAAAGAACTG
GAAACTATTTTAAAGGACCCGGCACTTACTGATGAACTTCGCCGCGAACTGAATGCGCTTGCCCCGGTAC
AGGGATAA