SecReT6
Protein ID: 397661092
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0081
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]80612..81715 [-]
Producthypothetical protein
NoteTssG
UniProt IDI6WD06
KEGG IDtea:KUI_0081
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-100, Aligned region: 22..319
Protein Sequence: 367 a.a.     [Download]
>gi|397661092|ref|YP_006501792.1| hypothetical protein KUI_0081 [Taylorella equigenitalis ATCC 35865]
MTMTKKVSKLPPDYWVNLAEYPYDHSFYQVLRYLDAKHQLRKPIGRNTSPSHEPFRMRQEPSMIFAPSNL
TRVDIHDNGRPPTISILGFGLWGPNGPLPLHLTEYAKERIYHHRDKTLSAFTDIFHHRLITLFYRAWADA
QNTVGLDLPNSPFKKYIGSFIGLGIPKALNNDSISDSAKLYFSSHLLRQTRNPEGLTQMLRKYFEVPVNI
LEFIPQWIFIEKNERSTLNGTVQLGVNCIIGTQVRDVQHKFRIQIGPVNRAKFESFFPGTKNAKQLIEWV
RLYVGYEFAWDVQLILLDEFRGQTRLGRNALLGLSSFSGKNTKKTDDFDELFIDYEARDRNKRHQDALIS
TMFVSDSDESEAPQATL
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|397661013|ref|NC_018108.1|:c81715-80612 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGACTATGACTAAGAAAGTTTCTAAACTTCCACCAGATTATTGGGTGAATCTAGCTGAGTATCCATACG
ATCACAGCTTCTACCAAGTATTACGTTATTTAGATGCCAAGCATCAATTGCGTAAACCTATAGGTCGCAA
TACGTCGCCTTCGCATGAGCCGTTCCGCATGAGGCAGGAACCGTCAATGATATTTGCACCTTCAAATCTA
ACACGGGTAGATATTCACGATAACGGAAGACCTCCCACTATTTCAATTTTAGGCTTCGGCTTGTGGGGTC
CTAACGGTCCACTTCCTCTTCATCTCACAGAGTATGCAAAAGAGCGCATATATCATCATCGCGATAAAAC
TTTATCGGCGTTTACGGACATATTTCATCATCGCCTAATTACGCTTTTTTATCGTGCTTGGGCTGATGCA
CAAAATACTGTCGGCCTGGATTTACCTAATTCACCTTTTAAAAAATACATTGGAAGTTTTATTGGACTGG
GCATACCAAAGGCATTAAATAACGACTCCATTTCCGATAGTGCGAAATTATATTTTTCAAGCCATCTTTT
AAGACAGACACGAAATCCTGAAGGTCTTACGCAAATGCTTAGAAAGTATTTTGAAGTACCTGTAAATATT
TTAGAGTTTATTCCTCAATGGATTTTTATCGAGAAAAATGAACGCTCAACTTTAAACGGCACTGTTCAAC
TGGGCGTAAATTGCATTATCGGCACTCAGGTTCGTGATGTTCAGCATAAGTTCAGAATACAAATTGGTCC
TGTTAATCGTGCAAAATTCGAATCCTTTTTCCCTGGCACAAAAAATGCTAAGCAACTCATAGAGTGGGTT
CGCCTTTATGTAGGTTATGAATTTGCATGGGATGTTCAGCTGATATTACTTGATGAATTCAGAGGGCAGA
CACGCTTAGGAAGAAATGCACTTCTTGGATTGTCTAGTTTCTCAGGCAAAAACACTAAAAAAACAGATGA
CTTTGATGAACTGTTTATAGACTACGAAGCTCGTGATAGAAATAAACGCCATCAGGATGCACTCATAAGC
ACTATGTTTGTTTCCGATTCAGATGAGAGCGAAGCCCCTCAAGCGACACTCTAG