SecReT6
Protein ID: 397661096
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0085
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]88304..88813 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDI6WXA9
KEGG IDtea:KUI_0085
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-33, Aligned region: 16..155
Protein Sequence: 169 a.a.     [Download]
>gi|397661096|ref|YP_006501796.1| putative lipoprotein [Taylorella equigenitalis ATCC 35865]
MKNLFKLVLLSLVATIVVACASTEKKLAVPYIVEISASPDSNQSNGRPSPIKVVVYELSSSDAFNQADFF
TLQQDYRKVLGDQVLGVKSVILSPGETKELKFSGSLNSKHIGVIGYYKEFNSSKWRLLVDLPEAKSTNIY
KFWQRSPKSARIRIQAGAKELVVLPPETK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|397661013|ref|NC_018108.1|:88304-88813 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGAAGAATTTATTTAAACTGGTGCTTTTATCACTTGTTGCTACTATTGTGGTGGCATGTGCTTCTACAG
AGAAAAAATTGGCTGTTCCATATATAGTTGAGATTTCAGCTTCTCCAGATTCTAATCAAAGCAACGGTCG
TCCTTCACCAATTAAAGTTGTTGTTTATGAATTATCTAGTTCTGATGCATTTAATCAAGCAGACTTTTTT
ACTCTACAACAAGACTACAGAAAAGTACTTGGTGACCAAGTTCTTGGAGTTAAATCAGTAATACTTTCTC
CAGGTGAAACTAAAGAACTTAAGTTCTCTGGTAGCTTAAACAGCAAACATATCGGTGTTATCGGCTACTA
TAAAGAATTTAACTCCTCTAAATGGAGATTATTAGTTGATCTTCCTGAAGCTAAATCTACAAACATTTAT
AAATTCTGGCAGCGTTCCCCTAAAAGTGCACGTATTAGAATTCAAGCCGGAGCGAAGGAACTTGTAGTAT
TGCCACCAGAAACAAAATAA