SecReT6
Protein ID: 397661097
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0086
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]88826..90178 [+]
Producthypothetical protein
NoteTssK
UniProt IDI6WD10
KEGG IDtea:KUI_0086
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-116, Aligned region: 19..442
Protein Sequence: 450 a.a.     [Download]
>gi|397661097|ref|YP_006501797.1| hypothetical protein KUI_0086 [Taylorella equigenitalis ATCC 35865]
MSIESKVIWTEGMFLRPQHFQQQDRYLDSKQKVLLEASSTYFWGFSQLEIDQNALKENKLSILKASGIFK
DGTAFSLGPNEVPMLPLDTLTREETIYLVLPSREASRQEVSYDEGSDLLARFSVVETTLSDVSDITLGEA
PVQIGKPKFRFMPDSEIDGSWIKLPLVHYKGKNKLNIVEVDSGFIQPTLNCTFVDNPITNHLSKVVELLN
LRSTELSKRFNPNNRTSASTTYETIILGIVNRNLILFRHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSI
AINKIPSYDHDALKVPLENLMSQIGDALNIVFEDAYVSIPLEDKGHGLSVGKVPDKSLFAKSQFVLAVKA
DLPGESVRKTFPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKDGDMWNQFEKS
STLALHLAGEYPGLDMLFWAVKNTDKRNSK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|397661013|ref|NC_018108.1|:88826-90178 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGAGCATAGAAAGTAAAGTTATATGGACTGAGGGCATGTTCTTGCGCCCTCAGCATTTTCAACAGCAAG
ATAGATATTTAGATTCAAAGCAGAAGGTGCTTCTTGAGGCATCTTCAACTTATTTTTGGGGTTTCTCTCA
GTTAGAAATTGACCAAAACGCACTTAAGGAAAATAAACTTTCAATATTAAAGGCTTCAGGTATTTTTAAG
GATGGGACAGCTTTTTCTTTGGGACCTAATGAGGTTCCTATGCTACCTTTAGATACTTTAACTAGAGAGG
AAACTATTTATTTAGTTTTACCTTCAAGAGAGGCTTCACGTCAGGAAGTTTCTTATGACGAAGGTAGCGA
TTTATTAGCTAGATTTAGTGTTGTTGAGACTACTCTATCCGATGTTTCCGATATAACTTTAGGTGAAGCA
CCTGTTCAAATAGGTAAGCCAAAATTTAGGTTTATGCCTGATTCTGAAATCGATGGAAGTTGGATTAAGC
TTCCACTTGTTCATTACAAAGGCAAAAATAAATTAAATATAGTTGAAGTTGATAGTGGATTTATCCAACC
AACTTTAAATTGTACGTTTGTTGATAATCCTATTACCAATCATCTTTCAAAAGTAGTGGAATTATTAAAT
CTTAGGTCTACTGAGCTTTCTAAGCGCTTTAATCCTAACAATAGAACTTCGGCTAGTACTACTTACGAAA
CAATTATTCTTGGTATCGTTAATAGAAATTTAATTTTATTTAGACACTTATATACGCTTGAGTATCTGCA
CCCAGAGGTGTTCTTCAGATACTTATCTATGTTGGTAGCAGAACTTGCAATGTTCCATCCAGATAGCATT
GCCATAAATAAAATCCCTTCTTATGACCACGACGCATTAAAAGTTCCACTTGAAAATCTTATGAGTCAGA
TAGGTGATGCACTTAATATCGTATTTGAAGATGCATACGTATCTATACCGCTTGAAGATAAAGGGCATGG
TCTTAGTGTGGGTAAAGTACCAGACAAAAGCCTTTTTGCAAAATCGCAATTTGTACTTGCTGTCAAAGCG
GATTTGCCAGGAGAGTCTGTACGCAAGACATTCCCTCAACAAGCAAAACTTGGACCTACAAATCGTATGC
GCGATCTTGTACATTTACAACTTCCAGGTATTACGCTTGAGCATATGGATCAAGTTCCTGCAGCATTGCC
ATACCATGCGGGTTATATCTACTTTAACCTAGTAAAAGATGGAGATATGTGGAATCAATTTGAAAAATCT
TCAACATTGGCACTGCATTTGGCGGGTGAATATCCTGGACTTGATATGTTATTCTGGGCTGTTAAAAACA
CTGACAAACGTAATTCGAAGTGA