SecReT6
Protein ID: 397661098
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0087
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]90186..91523 [+]
ProductOmpA-family protein
NoteTssL
UniProt IDI6XBZ7
KEGG IDtea:KUI_0087
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-70, Aligned region: 39..244
OmpA [PF00691], Evalue: 1.20E-18, Aligned region: 311..409
Protein Sequence: 445 a.a.     [Download]
>gi|397661098|ref|YP_006501798.1| OmpA-family protein [Taylorella equigenitalis ATCC 35865]
MSSRDYVDSKMGPWGQIHQQRYDDSNKIRPDNFVISGSNPLVAAANPLLTLLPQIRFSQHHDNVDMLREL
LVEEVRQFEVRAQEKGISKETILGARYCLCTAIDEACAMAPWGQQGLWSGKSLLVTYHNETWGGEKFFQL
LRKLSQNPENHIDLLELMYFCLMLGFEGRFRVIENGRSQLETLKQRLLLIIKKVRGAYPDTLSPHWKGDE
IINKIKRLPIPLWVVAVFGFALAVLAYILFSWLLGGKSDDVAYDIVKIKPPAMQIAVPVRVVRTEGPKRL
AQYLESEIRENLLTVRDESDRSVVELRGDEFFESGSADIKKQFESVVNRLGDALDETEGNILITGHTDNR
PIKTIRFPSNWDLSQARADAVAKIIESRLTQPNRIRSEGKADTMPVTSNDTPENRKRNRRVEITLLIPAQ
SKKSRPTTPFIVPTPEGTKTINPDN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|397661013|ref|NC_018108.1|:90186-91523 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGTCTTCTAGAGATTATGTAGATTCGAAGATGGGGCCTTGGGGGCAGATACACCAACAGCGCTACGATG
ATTCAAATAAAATTAGACCCGATAATTTTGTAATTAGTGGTTCCAACCCTTTGGTTGCGGCCGCTAATCC
ATTATTGACACTGCTACCACAAATTAGGTTCTCACAGCATCACGATAATGTGGATATGCTACGTGAATTG
TTGGTTGAAGAAGTTAGACAATTTGAAGTTAGGGCTCAAGAAAAGGGAATTAGTAAGGAGACTATTCTAG
GTGCTAGGTACTGTTTATGTACCGCAATAGATGAAGCTTGTGCCATGGCTCCTTGGGGGCAACAGGGATT
GTGGTCTGGTAAAAGCTTGTTAGTTACCTATCATAACGAAACATGGGGTGGTGAGAAGTTTTTCCAACTA
CTTCGTAAGCTTTCTCAAAATCCAGAAAATCATATTGATCTTCTAGAACTTATGTATTTCTGTTTGATGC
TTGGATTTGAAGGAAGATTCAGAGTTATTGAAAATGGACGTTCGCAATTAGAAACCCTGAAACAGCGCCT
GTTGCTTATTATTAAAAAAGTTAGGGGTGCCTATCCTGACACTCTTTCTCCGCATTGGAAGGGAGATGAG
ATTATAAATAAGATTAAACGCCTTCCAATTCCACTATGGGTTGTTGCAGTGTTTGGATTTGCATTAGCGG
TTTTAGCATATATATTATTTTCATGGCTACTCGGCGGAAAGTCAGATGATGTCGCATATGACATAGTTAA
GATCAAACCACCTGCTATGCAGATTGCTGTACCCGTTCGTGTTGTTAGAACTGAAGGACCTAAACGACTA
GCCCAATATCTTGAATCTGAAATCAGAGAAAACTTGCTTACTGTACGCGATGAGTCTGACCGAAGTGTCG
TGGAACTAAGGGGAGATGAATTCTTCGAATCAGGTTCTGCAGATATTAAAAAACAATTTGAATCTGTAGT
TAATCGTTTGGGCGATGCACTAGATGAAACAGAAGGTAATATTCTTATTACTGGACACACAGATAATAGA
CCTATCAAAACGATTCGATTCCCTTCAAACTGGGATCTATCACAAGCTAGGGCTGATGCCGTAGCTAAAA
TTATTGAATCTCGTTTGACACAACCTAATCGTATTAGGTCTGAAGGTAAAGCGGACACCATGCCTGTTAC
CTCTAACGATACACCAGAAAATAGAAAACGAAATCGTAGGGTTGAAATCACATTATTGATTCCTGCGCAA
TCTAAAAAATCCCGTCCGACCACTCCGTTTATAGTTCCAACACCTGAGGGTACAAAAACTATAAATCCAG
ATAATTAG