SecReT6
Protein ID: 397661102
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0091
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]98730..99791 [+]
Producthypothetical protein
NoteTssA
UniProt IDI6WD15
KEGG IDtea:KUI_0091
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-14, Aligned region: 52..111
Protein Sequence: 353 a.a.     [Download]
>gi|397661102|ref|YP_006501802.1| hypothetical protein KUI_0091 [Taylorella equigenitalis ATCC 35865]
MMNFDELFPSFDNDDCGANLEYDSDFLNLVQASVPKPEQQFGDAVIEAQPPDWAKVEKMALELCKRSCDV
RILQILTYAWTFQRGLVGYAQGIDLVHQALEKCWDSINPPLFEEDGYEDPMPRVNAISALGDLSTLGRGI
RSSKLLSDNYGNLTVREGEAIIDGSNDGFPGGKNRLSELLSQATQSENEIALAIPVAFNALQSIEDLVVE
KLGHDWRPDFPTIKSLFGSFVHLINSRPSTSSSEAVVESTEISESSTQSSDTSSDSSAKFASWREVQIKT
RADAILALEKACAYFEVYEPSHPAPFIIRRLQQAIPLNFFEMLKNLAPSGSEQFEQTWVPREEEDSSSSS
DDY
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|397661013|ref|NC_018108.1|:98730-99791 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGATGAATTTTGATGAGTTATTTCCCTCATTCGATAATGATGATTGTGGGGCCAATCTTGAGTATGATT
CAGATTTTCTGAATCTAGTACAGGCTTCTGTCCCAAAACCTGAACAGCAGTTCGGGGATGCTGTTATCGA
AGCCCAGCCGCCTGATTGGGCCAAAGTTGAAAAAATGGCATTGGAATTATGTAAGCGTTCATGTGATGTT
CGCATACTACAGATATTGACTTATGCCTGGACATTTCAACGTGGTCTCGTTGGCTATGCTCAGGGTATTG
ATTTAGTTCATCAGGCATTAGAAAAGTGTTGGGATTCTATTAATCCTCCGCTTTTTGAAGAAGATGGTTA
TGAAGATCCTATGCCTCGCGTAAATGCGATTTCGGCATTGGGTGATTTGAGCACCTTAGGTAGAGGTATT
CGTAGTTCAAAACTTTTATCGGATAACTACGGTAATTTAACTGTACGTGAAGGTGAAGCCATCATCGATG
GAAGTAACGATGGGTTTCCAGGTGGAAAAAATCGATTGTCTGAGCTTTTATCTCAAGCTACTCAATCCGA
AAATGAAATCGCTTTGGCTATTCCCGTTGCTTTTAATGCTTTACAAAGCATAGAGGATTTAGTAGTTGAA
AAGTTGGGTCATGATTGGCGTCCAGATTTTCCAACTATTAAGTCTTTATTTGGTTCGTTTGTTCACTTAA
TTAACTCTAGACCTTCAACTAGTAGTTCGGAGGCGGTTGTTGAAAGCACTGAAATTTCAGAATCATCAAC
TCAATCAAGTGATACATCTTCTGATTCTTCAGCTAAGTTTGCTTCTTGGCGTGAGGTTCAGATTAAAACT
AGGGCGGATGCGATATTGGCATTGGAGAAGGCTTGTGCTTATTTCGAAGTTTATGAGCCTAGTCATCCAG
CACCTTTTATTATTCGCAGATTGCAGCAAGCGATTCCTCTTAATTTCTTTGAAATGCTTAAGAACCTGGC
CCCATCTGGTTCTGAGCAGTTTGAACAGACTTGGGTTCCTAGAGAAGAAGAGGATTCAAGTAGTTCTTCT
GATGATTATTAA