SecReT6
Protein ID: 397661103
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0092
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]99829..100362 [+]
Producthypothetical protein
NoteTssB
UniProt IDI6XC01
KEGG IDtea:KUI_0092
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-60, Aligned region: 12..165
Protein Sequence: 177 a.a.     [Download]
>gi|397661103|ref|YP_006501803.1| hypothetical protein KUI_0092 [Taylorella equigenitalis ATCC 35865]
MGSRSKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMAVMSDLTGKSTVEQPEVSERKFSEIDVDN
FDDRMKAIAPRVDVSVPNTLTGQGRLYVDLTFNSMDDFSPANIARNVEPLAKLLEARTELSNLLTYMDGK
SGAEELINKVLENPALLKSLAAAPNKSSSDDAQQDQE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|397661013|ref|NC_018108.1|:99829-100362 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGGGCTCAAGAAGTAAAAGTGGTCAAAAGTTTATTGCACGTAACCGTGCACCACGTGTTCAAATTGAAT
ATGATGTAGAGATCTACGGTGCAGAGCGTAAAATTCAGCTCCCATTTGTTATGGCAGTTATGTCAGATTT
GACTGGTAAGTCTACTGTGGAACAACCTGAAGTAAGTGAACGTAAATTTAGCGAAATCGATGTAGATAAC
TTTGATGATCGCATGAAAGCAATTGCCCCTCGCGTGGATGTTTCTGTTCCAAATACTCTTACTGGTCAAG
GTAGACTTTACGTTGACCTTACTTTTAACAGTATGGATGATTTTAGCCCAGCAAACATTGCCCGTAACGT
TGAGCCTCTAGCAAAATTATTAGAAGCTAGGACTGAGCTTTCAAACTTATTAACTTATATGGATGGTAAA
TCTGGTGCTGAAGAATTGATTAACAAAGTTCTTGAAAATCCTGCTTTACTTAAATCCCTTGCTGCTGCTC
CAAACAAATCATCTTCAGATGATGCTCAACAAGATCAAGAATAG