SecReT6
Protein ID: 397661104
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0093
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]100371..101864 [+]
Producthypothetical protein
NoteTssC
UniProt IDI6W2D7
KEGG IDtea:KUI_0093
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.10E-197, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|397661104|ref|YP_006501804.1| hypothetical protein KUI_0093 [Taylorella equigenitalis ATCC 35865]
MATEALKQSQEKGTIEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSDSYITIQNIIA
EIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVNNTETDEMLKIRFMPISKKELGRTLKRHKGTAWDQSP
IFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMAKISAAAHCPFISGADPSLMQMDSWQELSN
PRDLSKIFTNTEYAAWRSLRETDDSRYLGLTLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANS
AYAMAANINRSFKEYGWCTSIRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYDDPDATANARLSARLPYLFACCRFAHYLKCIVRDKVGSFTSRIEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKKAG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|397661013|ref|NC_018108.1|:100371-101864 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGGCTACTGAAGCTTTAAAACAAAGTCAAGAAAAAGGCACGATTGAAGTTGAGGGCTTATCTTCACTTC
TTAAAAAAGAATTTAAACCTAAAACAGAAGAAGCACAAAGTGCTGTTGAAAGTGCAGTTAAAACTCTAGC
TGAACAAGCACTTTCATCTGCTGTAACTATCTCCTCAGATTCATACATTACTATTCAAAATATTATTGCT
GAGATTGATCGTAAATTATCTCAACAAATTAACGTAATTCTTCATAACGAAGAGTTCCAAAAACTAGAAG
GTGCTTGGCGCGGTCTACATTACTTAGTTAATAACACTGAAACAGATGAGATGTTAAAAATCCGTTTCAT
GCCTATTTCTAAAAAAGAATTAGGTCGTACATTAAAACGTCACAAAGGTACAGCATGGGACCAAAGTCCT
ATATTCAAACGTATATACGAAGAAGAGTATGGTCAATTCGGTGGTGAACCTATCGGATGTATCGTTGGAG
ATTATCACTTCGATCACAGTCCTCCAGATGTAGAGCTTTTAGGTGAAATGGCTAAGATATCTGCTGCTGC
TCACTGCCCATTTATCTCTGGTGCTGACCCTTCACTTATGCAGATGGATTCATGGCAGGAACTTTCAAAT
CCACGTGATTTAAGCAAAATCTTCACAAATACTGAGTATGCAGCATGGAGAAGCCTACGTGAAACTGATG
ACTCACGTTATTTAGGTTTGACATTGCCTCGCTTCCTGGCTCGTCTACCATACGGTGCTCGTACTAATCC
AGTTGATGAGTTTGATTTCGAAGAAGATACAGAAGGTGCAAACCACAATAACTACACTTGGGCTAACTCT
GCATATGCGATGGCTGCAAATATCAACCGTTCATTTAAAGAGTATGGTTGGTGTACATCAATTCGTGGTG
TAGAGTCAGGTGGTGCGGTTGAAGGCTTACCTACTCACACATTCCCTACCGATGACGGTGGCGTGGATAT
GAAATGTCCAACTGAAATTGCTATTTCAGACCGTCGCGAAGCTGAACTAGCTAAAAATGGTTTCATGCCA
CTAGTTCACCGTAAAAATTCAGACTTTGCTGCGTTTATCGGAGCTCAGTCATTGCAAAAACCTGCAGAGT
ATGATGATCCTGATGCAACAGCAAATGCTCGTCTTTCTGCACGTTTACCTTATTTGTTTGCTTGCTGCCG
TTTCGCACACTACTTAAAATGCATCGTGCGTGATAAAGTGGGTTCATTTACTAGTCGTATTGAGATGGAA
GATTGGTTGAATACTTGGATTATGAACTATGTTGATGGAGATCCAGCTAACTCTTCTCAAGAAACTAAAG
CTCGTAAACCACTTGCTGCTGCTGAAGTACAAGTTGCGGAGATTGAAGATAATCCAGGCTATTATGCTGC
TAAATTCTTCTTGCGTCCGCATTATCAGTTAGAGGGTTTAACCGTTTCATTAAGGTTAGTCTCTAAACTG
CCATCCCTTAAAAAGGCTGGCTAA