SecReT6
Protein ID: 397661105
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0094
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]101932..102417 [+]
Producthypothetical protein
NoteTssD
UniProt IDI6X7Z5
KEGG IDtea:KUI_0094
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-36, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|397661105|ref|YP_006501805.1| hypothetical protein KUI_0094 [Taylorella equigenitalis ATCC 35865]
MAVDMFLKISSVEGESKDSKHAKWTDIESFAWGATQPGSMATGGGGGTGKASFNDLHVICRIDRAAPTVM
KHCATGKHLDKVEISVNKAGGEQVEYSKITLEDVLVTSVQYTGEKDGDAMMVSYSFQGAKVKQQYWEQSD
KGTKGAESVVGYDIKQNKATA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|397661013|ref|NC_018108.1|:101932-102417 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGGCTGTTGATATGTTCTTAAAAATTTCAAGTGTTGAAGGTGAATCTAAAGACTCTAAACACGCTAAAT
GGACTGACATCGAATCATTCGCTTGGGGTGCTACTCAACCTGGTTCTATGGCTACTGGTGGTGGCGGCGG
TACTGGCAAAGCTAGTTTCAACGACCTTCACGTTATTTGCCGCATCGACCGTGCTGCACCTACAGTAATG
AAACATTGTGCTACTGGTAAACACTTAGACAAAGTTGAAATTTCTGTAAACAAAGCTGGTGGCGAACAAG
TTGAATACTCTAAAATCACTTTAGAAGACGTTCTTGTTACTTCAGTTCAATACACTGGTGAAAAAGATGG
CGACGCTATGATGGTTAGCTACTCTTTCCAAGGTGCTAAAGTTAAACAACAATACTGGGAGCAATCAGAT
AAAGGTACTAAAGGTGCTGAATCTGTTGTTGGTTACGACATCAAACAAAATAAAGCTACTGCTTAA