SecReT6
Protein ID: 397661106
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0095
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]102505..103338 [+]
ProductImpE-like protein
NoteTagJ
UniProt IDI6WXC0
KEGG IDtea:KUI_0095
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.20E-35, Aligned region: 140..266
TPR_11 [PF13414], Evalue: 0.0008, Aligned region: 23..56
TPR_11 [PF13414], Evalue: 0.0008, Aligned region: 108..128
TPR_19 [PF14559], Evalue: 0.0018, Aligned region: 25..59
TPR_19 [PF14559], Evalue: 0.0018, Aligned region: 99..127
TPR_17 [PF13431], Evalue: 0.0042, Aligned region: 24..50
TPR_17 [PF13431], Evalue: 0.0042, Aligned region: 118..128
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 14..39
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 31..60
TPR_14 [PF13428], Evalue: 0.0089, Aligned region: 97..128
Protein Sequence: 277 a.a.     [Download]
>gi|397661106|ref|YP_006501806.1| ImpE-like protein [Taylorella equigenitalis ATCC 35865]
MNTAGIFKTNSIDEVIEQTKDKVRKNPDSADLRANLFQLLALKGDWTRAVDSLKLSAEMNSQAQPVAMLY
VAAVNAEVDRQNVFQGNGRPAIFGDADEWMGYLIASIEEKDPSKSEELLDKAMELAPEVSGTIKTRNGEE
VNFEWLADGDSRLGPMLEFLNNGQYGWVPFNEIESLRIIEPSGISDLIWSQAELVLTNGRSIVGMVPNRY
PGDYASLDDKFNLGHRTEWVPLFESEESEYYKGVGQKTYISDLGDHPILEIESIKFNPVLTQDDAES
 
Nucleotide Sequence: 834 bp     [Download]
>gi|397661013|ref|NC_018108.1|:102505-103338 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGAACACAGCTGGTATTTTTAAAACAAATTCTATTGATGAAGTTATTGAGCAAACCAAGGATAAAGTTC
GTAAGAATCCAGACAGTGCGGATTTGCGTGCAAATTTATTTCAGCTTTTAGCACTTAAAGGGGATTGGAC
TAGAGCTGTTGATTCTCTGAAACTAAGTGCTGAGATGAATTCGCAAGCACAACCCGTTGCCATGCTTTAT
GTAGCCGCTGTTAATGCTGAGGTTGACAGGCAAAACGTCTTCCAGGGTAATGGCAGACCTGCTATTTTTG
GTGATGCTGACGAGTGGATGGGGTATCTAATTGCCTCTATTGAGGAAAAGGATCCATCTAAATCTGAAGA
ATTGTTAGATAAAGCTATGGAACTTGCTCCTGAAGTATCAGGAACTATTAAGACTAGAAACGGTGAAGAA
GTTAATTTTGAATGGCTAGCAGACGGAGATAGCCGCCTAGGTCCTATGTTGGAATTTCTAAATAATGGTC
AATATGGTTGGGTACCATTTAATGAAATCGAATCGCTTCGTATCATTGAACCTTCAGGTATCTCTGATTT
AATATGGTCTCAGGCTGAATTAGTTCTTACTAACGGAAGATCTATAGTAGGCATGGTGCCTAATCGTTAT
CCTGGTGATTATGCTTCACTAGATGATAAATTCAATCTAGGACATCGTACAGAGTGGGTACCACTTTTTG
AATCAGAAGAATCAGAATACTATAAAGGTGTAGGTCAAAAGACATACATTTCTGATTTGGGCGATCACCC
AATTTTAGAAATTGAATCTATTAAATTTAATCCAGTTTTAACTCAGGATGATGCGGAAAGCTGA