SecReT6
Protein ID: 397661107
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0096
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]103349..103912 [+]
Productlysozyme-like protein
NoteTssE
UniProt IDI6WD21
KEGG IDtea:KUI_0096
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-17, Aligned region: 54..163
Protein Sequence: 187 a.a.     [Download]
>gi|397661107|ref|YP_006501807.1| lysozyme-like protein [Taylorella equigenitalis ATCC 35865]
MITAHQKRKLDSISRKSDQDYKDKLQPVLLDKLTDEHPERRKELREAATVINFEQLKKSVLRDLGWLLNT
VNLESIESLDGYNHVKSSTINFGVFPVAGQKMSEINHIEIQNQVRNAIINFEPRILPNDLEVICELEESD
LEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIKDEGRGSL
 
Nucleotide Sequence: 564 bp     [Download]
>gi|397661013|ref|NC_018108.1|:103349-103912 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGATTACAGCTCATCAAAAAAGAAAACTCGATAGCATCTCTAGAAAAAGCGATCAGGATTACAAAGATA
AACTTCAGCCTGTATTGCTTGATAAACTTACTGACGAGCATCCAGAAAGACGAAAAGAACTCAGGGAAGC
TGCTACAGTTATTAATTTTGAACAACTAAAAAAGTCCGTACTTAGAGATTTAGGTTGGTTGCTAAACACT
GTTAATTTAGAATCTATTGAGTCTTTGGACGGATATAATCACGTTAAAAGTTCAACTATAAATTTTGGCG
TTTTCCCTGTAGCTGGTCAGAAAATGTCAGAAATCAATCATATTGAAATTCAGAATCAAGTAAGAAACGC
AATAATTAATTTTGAGCCTAGAATTTTACCTAATGATCTTGAAGTTATCTGTGAATTAGAAGAGTCAGAT
TTAGAACACTACAACGTGTTGTCTCTTATAATCAAGGGCAGATTATGGTGTAACCCTCATCCTATGGAGT
TTTTTCTACGTACCTCAGTTGACTTAGAGTCAGGTCACATGGAGATTAAGGACGAAGGTAGAGGATCCTT
ATAA