SecReT6
Protein ID: 397661108
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0097
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]103912..105807 [+]
Producthypothetical protein
NoteTssF
UniProt IDI6XC06
KEGG IDtea:KUI_0097
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-189, Aligned region: 6..630
Protein Sequence: 631 a.a.     [Download]
>gi|397661108|ref|YP_006501808.1| hypothetical protein KUI_0097 [Taylorella equigenitalis ATCC 35865]
MENDFIEYYNRELAYIREMGREFAEQYPKVASRLGMEGIQVPDPYVERLMEGFSFLTARIHKKMDAEFPQ
FTQNLLEVLYPHYVSPTPAIGIIDFDVNSKKGDLVKGYTLPKGTVFRARTGGKECRFSTGSEVTFHPLVI
EEAEVTSSMSDLPPKLLKSFRGNKQIRSALRVQIKVVGGSNIADLKNFNKLNFFLNGEEVYTHKLLEMLM
AHTIGIVVHDHERPVRWTKFLDVKNLKHEGFETNQSLLPTDSRVFQGYRLLHEYFAFPYKYLYVSLSGIQ
QAITLPEELQKQKIKSFEVTFLFDKIAHDLEGVITAENLRLHSVPVINLFPMLANRINILPNAHEYHVVV
DKAKPLDYEIYSLTKVTVNAPGAKETKEFRPFFDVYGAEGQTIHQFYSVRREARKASLSANQISRRTGYR
GSEIFISIVDVDNPPYDNHTVFGLNIETMSTNRDLPYIFNSGGDVDFRFNVSVPVDRISFIKKPTRTRAP
IGREAYSWRLINHLNLNYLNLLDSNEESGAEAVRELLHIYSDLGDPMLARQIQGIRSIKLEPIYRRMPVR
GSIVFGRGVSIKVLVDENEFAGISPYLFGSILDQFFSRHVSINMLTELELSSLQSGLIATWKPRLGGRPT
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|397661013|ref|NC_018108.1|:103912-105807 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGGAAAACGATTTTATTGAGTACTACAATCGCGAGTTAGCTTATATTCGCGAAATGGGACGAGAATTTG
CTGAGCAATATCCAAAAGTTGCTAGTCGTTTGGGTATGGAGGGCATACAAGTTCCCGACCCTTATGTTGA
GCGTCTTATGGAGGGCTTTAGCTTTTTAACAGCCCGTATCCATAAAAAAATGGATGCCGAGTTTCCTCAA
TTTACACAGAATTTGCTAGAAGTTCTGTACCCACACTACGTATCACCTACACCTGCAATCGGAATAATCG
ACTTCGATGTTAATTCTAAAAAGGGGGACCTAGTAAAAGGGTATACATTGCCAAAAGGTACAGTTTTCAG
AGCTAGGACTGGTGGCAAAGAGTGCCGATTTTCTACTGGAAGTGAGGTTACATTTCACCCATTAGTAATT
GAAGAAGCTGAAGTTACATCCTCTATGAGCGACCTACCTCCTAAACTTTTAAAAAGTTTTAGAGGAAACA
AGCAAATTAGAAGTGCACTTAGAGTTCAAATCAAAGTCGTAGGCGGAAGTAATATTGCAGATTTGAAAAA
CTTCAATAAGTTGAATTTTTTTCTTAATGGCGAAGAGGTTTATACTCACAAACTCCTTGAGATGCTTATG
GCTCACACTATCGGCATAGTTGTGCACGATCATGAGAGACCAGTTAGATGGACAAAATTTCTTGATGTAA
AAAATCTCAAGCATGAGGGGTTTGAGACGAATCAATCATTATTGCCAACTGATAGCAGGGTTTTTCAGGG
ATACAGACTACTTCATGAATATTTTGCATTTCCGTACAAGTATTTATATGTAAGTTTAAGTGGGATACAG
CAAGCAATAACATTGCCAGAGGAACTGCAAAAGCAAAAGATCAAGTCTTTTGAGGTCACTTTCCTGTTCG
ATAAAATTGCACATGACCTTGAGGGTGTAATTACAGCTGAAAACTTGCGTCTACATAGTGTTCCAGTTAT
TAATTTGTTTCCTATGTTGGCTAATAGGATAAATATCCTCCCGAATGCTCATGAGTATCATGTAGTCGTG
GATAAGGCTAAACCTCTTGATTATGAAATCTACTCGCTGACTAAGGTTACGGTAAATGCTCCTGGAGCTA
AAGAGACTAAGGAATTTCGACCATTTTTTGATGTTTATGGAGCTGAAGGTCAAACTATCCATCAGTTTTA
TTCTGTTAGGCGTGAAGCACGTAAAGCATCTCTTAGTGCTAATCAAATTAGCAGAAGAACTGGTTATCGA
GGAAGTGAAATCTTTATTTCAATCGTAGATGTCGATAATCCTCCTTACGACAATCATACAGTATTTGGAC
TTAATATTGAGACGATGTCCACGAATAGGGACTTGCCATATATTTTTAACAGTGGTGGAGATGTTGATTT
TAGATTTAATGTTTCTGTTCCGGTAGATAGGATAAGTTTTATAAAAAAACCAACTCGTACAAGGGCTCCA
ATAGGCAGAGAAGCTTATTCGTGGCGGTTGATCAATCACTTAAATTTAAATTACCTTAATTTGTTAGACT
CTAATGAGGAATCTGGTGCGGAGGCGGTTAGAGAATTATTGCATATTTACTCTGACCTTGGAGATCCGAT
GTTAGCTAGACAAATTCAGGGGATTAGAAGCATTAAACTTGAGCCTATTTATAGACGTATGCCTGTCAGA
GGTTCTATAGTATTTGGTCGTGGAGTTAGTATTAAAGTATTGGTCGATGAAAATGAATTTGCAGGTATTA
GTCCTTATTTATTTGGATCAATTTTAGACCAATTCTTTTCTCGTCACGTTTCTATTAATATGCTCACAGA
GCTTGAATTGTCATCTTTGCAGTCAGGATTGATAGCTACTTGGAAACCTAGACTTGGTGGTAGGCCCACA
GTGTAA