SecReT6
Protein ID: 397661120
SecReT6 ID680
T6SS typei3
Gene symbol-
Locus tagKUI_0111
StrainTaylorella equigenitalis ATCC 35865
Repliconchromosome [GenBank: NC_018108] [Browse all T6SS(s) in this replicon]
Location [Strand]117344..118897 [+]
Producthypothetical protein
NoteTssI
UniProt IDI6X813
KEGG IDtea:KUI_0111
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-73, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-24, Aligned region: 364..456
Protein Sequence: 517 a.a.     [Download]
>gi|397661120|ref|YP_006501820.1| hypothetical protein KUI_0111 [Taylorella equigenitalis ATCC 35865]
MADRHAIAHVAIPSLQFLSLNGHESLSNLYEFEVELASMDHFIDVRKMLGTQLTVEIESFMSAPRYLTGR
VRKFELVGTDQDGSEYLVYKASVVPPLWYLTQGKDYKIFQDKKIEDIIKEVLDKFEIKYEFKLSGSYRNW
EYVVQYDESPFNFVSRLMEHEGMYYWFKHDKNESTMIIADDASAHEEFPSYEVLNYLSSGFKIFDSREVI
TSWRHNAVVTPSKYTVVDFDFRKPSFALDTDKENQLDGDDSIEVYEWQGGYQELSDGDNYTKLRLEELKV
PQEIVEADSNIRGICPGYKFTLANHPRVAENQGYVVVSAHYMIQVNGYSSNSGRQDFFSTSFYSLPASIQ
FRAARRSPEPKTHGPQTATVVGPSGEVIYTDKYGRVKVQFHWDRDGKKDENSSCWVRVSSPWASTGFGGL
QIPRIGDEVVIDFIGGNPDRPLIIGRVYNEDNQPLVNLPDDSHTSGFRTRTIQGGSDNQNFLLFRDKQGD
ELVDIQAEKDMKIFVKNDFYLTVGNCG
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|397661013|ref|NC_018108.1|:117344-118897 Taylorella equigenitalis ATCC 35865 chromosome, complete genome
ATGGCAGACCGTCACGCAATCGCACATGTAGCGATACCTAGTCTTCAGTTTTTAAGTCTTAACGGGCATG
AATCCCTTTCAAATTTGTATGAATTTGAAGTTGAACTTGCTTCAATGGATCATTTTATTGACGTTAGAAA
AATGCTTGGAACTCAGCTTACCGTTGAGATTGAGTCTTTTATGTCGGCTCCTAGGTATTTAACTGGTCGT
GTACGTAAATTTGAACTAGTAGGTACTGATCAAGATGGTTCTGAATATTTAGTTTACAAAGCAAGTGTTG
TGCCACCTCTATGGTACCTAACCCAAGGTAAAGATTATAAAATTTTCCAAGATAAAAAAATTGAAGACAT
AATCAAAGAAGTATTAGACAAATTTGAAATTAAATATGAATTTAAACTTTCAGGTTCGTATAGAAATTGG
GAATACGTAGTTCAATATGATGAATCACCGTTCAATTTCGTTTCAAGGTTAATGGAACATGAAGGGATGT
ATTACTGGTTTAAGCATGATAAAAATGAATCGACTATGATTATCGCTGATGATGCTTCCGCTCACGAAGA
ATTCCCTTCTTATGAGGTTCTTAATTATTTGTCATCTGGATTTAAGATATTTGATTCTAGAGAGGTTATT
ACTTCATGGAGGCATAATGCTGTAGTAACACCTTCTAAATATACAGTTGTAGATTTTGATTTTAGAAAGC
CAAGTTTTGCATTAGATACCGATAAAGAAAACCAATTAGATGGTGATGATAGTATTGAAGTTTATGAGTG
GCAAGGGGGGTATCAGGAATTATCCGACGGAGACAATTATACTAAATTAAGACTCGAGGAATTGAAAGTT
CCTCAGGAGATTGTAGAAGCGGATTCAAACATAAGAGGAATTTGTCCAGGATATAAATTCACTCTGGCAA
ATCATCCTAGAGTTGCTGAAAATCAAGGTTATGTTGTTGTCAGTGCTCACTATATGATTCAAGTAAATGG
ATATTCCTCCAATTCTGGCAGACAAGATTTCTTTAGTACTAGTTTCTATTCTTTACCAGCATCTATTCAA
TTTCGTGCTGCACGAAGATCTCCTGAGCCTAAAACTCATGGTCCGCAAACTGCTACAGTGGTAGGTCCAT
CTGGAGAAGTTATTTACACTGACAAATATGGTAGGGTTAAAGTGCAATTCCATTGGGATCGTGATGGTAA
AAAAGATGAGAACTCTTCATGTTGGGTTCGTGTATCAAGTCCTTGGGCTAGTACTGGTTTTGGTGGTTTA
CAAATTCCTCGTATTGGAGATGAAGTTGTTATTGATTTTATTGGTGGTAACCCAGATAGACCATTAATTA
TCGGCAGGGTTTATAACGAGGATAACCAGCCTTTAGTTAATCTACCAGATGATTCTCATACCTCAGGCTT
CCGCACAAGAACAATTCAAGGTGGTAGCGACAATCAAAATTTCCTTTTGTTTAGAGACAAACAAGGAGAT
GAATTGGTTGACATTCAAGCAGAAAAAGATATGAAGATATTTGTTAAGAATGACTTTTACTTAACAGTTG
GTAATTGCGGTTAA