SecReT6
Protein ID: 397685911
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_03970
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]878730..879926 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDI6Z1R5
KEGG IDpsj:PSJM300_03970
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-10, Aligned region: 29..97
Protein Sequence: 398 a.a.     [Download]
>gi|397685911|ref|YP_006523230.1| FHA domain-containing protein [Pseudomonas stutzeri DSM 10701]
MELVFDVVGAQQFAPGLQSSKTFRQSGGVIGRAEGCDWVIPDRKRVLSGRHGTVSYRDGAFFLTDTSSNG
IQLKDSGASLTKGQPQRIEHGSVYCLGDYEIRARLIQTPSMFEADVGRSQPAGSVIPDDAFLDLDPLIAM
DQQERVYAQTDDLDLALGSPRQQTPQRDYARIDMESLSLPELVEPRVVPEPAPAAVPEQLPLAFWERFGE
ALGIDLDGMDEAAREALAIDAARLLRQSVSSLQQSLRTRSELKNELRLALTTVQSAGNNPLKHSVDSAEA
LNALLRGGKPGQLPAEQAVSRAFRDIQAHQVALLAASRAAVKAMFEQFSPEQLVLRYERDGHKPLFATAA
SRWRAYRKLHLALGQDDDWSDRLFARDFAKAYEEQVRLIATLDSPVQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|397685123|ref|NC_018177.1|:878730-879926 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGGAATTGGTTTTCGACGTGGTCGGCGCGCAGCAGTTCGCGCCAGGCCTGCAGTCCAGCAAGACATTCA
GGCAGTCCGGTGGAGTGATCGGGCGCGCAGAAGGGTGCGACTGGGTGATACCCGATCGCAAGCGCGTACT
GTCCGGTCGCCACGGGACGGTCAGCTATCGTGACGGCGCCTTCTTCCTGACCGATACCAGCAGCAACGGT
ATCCAGCTCAAGGACAGCGGCGCCAGCCTGACCAAGGGCCAGCCGCAACGCATCGAGCATGGCAGCGTGT
ACTGCCTCGGCGATTACGAGATTCGGGCACGGCTGATTCAGACCCCGTCCATGTTCGAGGCCGATGTCGG
GCGTTCACAACCCGCCGGTAGCGTCATTCCCGACGACGCTTTCCTGGATCTCGACCCGTTGATCGCCATG
GATCAGCAGGAGCGCGTCTACGCGCAAACCGACGATCTCGATCTCGCCCTGGGCTCGCCGCGCCAGCAGA
CCCCACAGCGCGACTATGCCCGCATCGATATGGAAAGCCTGTCGCTGCCGGAGCTGGTCGAGCCGCGGGT
CGTGCCAGAGCCTGCTCCAGCAGCCGTGCCGGAACAGCTGCCGCTGGCCTTCTGGGAGCGCTTCGGCGAG
GCGCTGGGCATCGATCTGGATGGCATGGATGAGGCCGCCCGCGAAGCACTGGCCATCGATGCGGCGCGCT
TGCTCAGGCAGAGCGTTTCAAGCCTGCAGCAGAGTCTGCGTACCCGGAGCGAACTGAAGAACGAGCTGCG
GTTGGCGCTGACCACCGTGCAGAGCGCGGGCAACAATCCGCTCAAGCACAGCGTCGACAGCGCCGAGGCC
CTGAACGCGCTGCTGCGTGGCGGCAAGCCCGGGCAGTTACCCGCCGAACAAGCCGTCAGTCGTGCGTTCC
GCGACATCCAGGCCCATCAGGTGGCGCTGCTCGCGGCCAGCCGTGCCGCCGTCAAGGCGATGTTCGAGCA
GTTTTCGCCGGAACAGTTGGTGCTGCGCTACGAGCGCGACGGCCACAAACCATTGTTCGCCACCGCGGCG
AGCCGCTGGCGGGCTTACCGCAAGCTGCACCTGGCACTCGGACAGGACGATGATTGGAGTGATCGTCTGT
TCGCCCGGGATTTTGCCAAGGCGTATGAAGAGCAGGTACGCCTGATCGCCACACTCGATTCCCCCGTTCA
AGGATGA