SecReT6
Protein ID: 397685913
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_03980
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]880418..881749 [+]
Producthypothetical protein
NoteTssK
UniProt IDI6ZXT9
KEGG IDpsj:PSJM300_03980
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-148, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|397685913|ref|YP_006523232.1| hypothetical protein PSJM300_03980 [Pseudomonas stutzeri DSM 10701]
MSLHKVVWQEGMLLRPQHFQQNDRYFDYQLKVRTQKLNNYAWGFFAQEIDRQFLNMGKLVVSQASGILPD
GSLFDLGDQREPLGLDIPPNTGSTSVYLALPLVTGNHIETRRPEQKDVLARYTAFDTEVADSNAGDSGSS
QVSTGRMDFRLLLGEQENDQAYVKLKLCEIMDTTPDGVISLDPDFIPTYVNFQASSYLLSCLKEVISMLA
HRGDTLAERIRASGKVGGAEVGDFMMLQLINRHEPVLRHYLGVDQVHPEQLYRELLGLLGELATFSSESK
RPRLESRYQHSDQGSSFRKLMDAIRQVLSMVLEQHAIELLLQQRQYGIQVSPLHDHKLLGSASFVLAASA
QCDSEELRTRLPAHLKVGPVERIRQLVNLHLPGIRIKPLPVAPRQIPFHAGKTYFALELSPEDQAQLERS
GGFAFHVSGDFTGLELKFWAVRD
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|397685123|ref|NC_018177.1|:880418-881749 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGAGTCTGCATAAAGTCGTCTGGCAGGAAGGCATGCTGCTGCGCCCCCAGCATTTCCAGCAGAATGATC
GCTACTTCGATTACCAGCTGAAGGTTCGCACGCAGAAGCTGAACAATTACGCCTGGGGCTTCTTCGCCCA
GGAGATTGATCGCCAGTTCCTGAACATGGGCAAGCTGGTCGTCAGCCAGGCCAGCGGCATTCTCCCCGAT
GGCAGCCTGTTCGACCTGGGCGATCAGCGCGAGCCGCTGGGGCTGGACATTCCGCCGAATACCGGCAGCA
CGTCGGTATATCTCGCGCTGCCGTTGGTGACCGGCAACCACATAGAAACCCGCCGCCCCGAACAGAAGGA
CGTGCTGGCGCGCTATACCGCCTTCGATACCGAAGTGGCCGATTCCAACGCGGGGGATAGCGGCAGCAGT
CAGGTCAGCACCGGGCGCATGGACTTTCGCCTGCTGCTTGGCGAGCAGGAGAACGACCAAGCCTACGTCA
AGCTCAAGCTCTGCGAAATCATGGACACCACGCCGGATGGGGTGATCAGCCTGGATCCGGACTTCATCCC
TACCTACGTCAATTTCCAGGCCTCGAGTTACCTGCTGTCCTGCCTGAAGGAAGTGATCAGCATGCTCGCG
CACCGTGGCGATACCCTTGCCGAGCGCATCAGGGCGAGCGGCAAGGTGGGCGGTGCGGAGGTCGGCGATT
TCATGATGCTACAGCTGATCAACCGCCACGAACCGGTGCTGCGGCATTACCTCGGTGTCGACCAGGTTCA
TCCCGAGCAGCTCTATCGCGAGTTGCTGGGCCTGCTTGGCGAGCTGGCCACCTTTTCCAGCGAGAGCAAG
CGGCCGCGACTGGAGAGCCGCTACCAGCACAGCGATCAGGGCTCAAGTTTCCGCAAGCTGATGGACGCGA
TTCGCCAGGTGCTGTCGATGGTGCTCGAGCAACATGCCATCGAGTTGCTGCTGCAGCAGCGCCAGTACGG
CATTCAGGTCTCGCCGCTGCATGACCACAAACTGCTCGGCTCGGCATCCTTCGTGCTCGCGGCGAGCGCC
CAGTGCGATTCGGAAGAGCTGCGTACGCGCCTGCCTGCCCACCTGAAAGTGGGCCCGGTGGAGCGCATTC
GCCAACTGGTCAACCTGCATCTGCCGGGTATCAGGATCAAGCCGCTGCCGGTGGCACCGCGGCAGATCCC
CTTCCATGCGGGCAAGACTTACTTCGCACTGGAACTCAGCCCCGAGGACCAAGCCCAGCTGGAGCGGTCC
GGCGGCTTCGCCTTCCATGTGTCCGGCGACTTCACCGGGCTTGAACTGAAATTCTGGGCAGTCAGGGATT
GA