SecReT6
Protein ID: 397685914
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_03985
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]881754..882638 [+]
Productouter membrane protein
NoteTssL
UniProt IDI6ZCD2
KEGG IDpsj:PSJM300_03985
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.70E-71, Aligned region: 61..266
Protein Sequence: 294 a.a.     [Download]
>gi|397685914|ref|YP_006523233.1| outer membrane protein [Pseudomonas stutzeri DSM 10701]
MIREMDYGQDDKTVIVNRGGEEASQSPLTDFAVPPKFEQLEERMIYAARLRPAEVFNISLNPLVAAASSL
LSEVVRLKHSPEGEDFQALHARLTGAIKLFEHRALHDGCESSQVMAARYVLCTVLDEAVVTTPWGNESEW
SQMSLLSNFHNETFGGEKFFQLLERLSRNPVKHLPMLELLYLCLSLGFEGKYRVLPRGMLELEAVRDSLY
RQIRQMRGDVPRELSPHWEGLKDTRRRLVRIVPWWMVALFTLACLGVMYSGFAWVLSEQRSTVLQPYQSL
DADSVDSQLSSGMN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|397685123|ref|NC_018177.1|:881754-882638 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGATCAGAGAAATGGACTACGGGCAGGATGACAAGACGGTAATCGTCAACCGCGGCGGCGAAGAGGCCT
CGCAGAGCCCACTGACGGATTTTGCCGTGCCACCGAAATTCGAACAGCTGGAGGAGCGGATGATCTACGC
CGCTCGCCTGCGCCCGGCGGAAGTCTTCAACATCAGTCTCAACCCGCTGGTGGCCGCGGCCTCGTCCCTG
CTTTCGGAAGTGGTACGCCTCAAGCACAGCCCCGAGGGCGAGGATTTCCAGGCGCTGCACGCAAGATTGA
CCGGCGCGATCAAGCTGTTCGAACACCGGGCGTTGCACGATGGCTGTGAAAGCAGCCAGGTGATGGCAGC
CCGTTATGTGCTCTGCACGGTGCTCGACGAGGCGGTGGTGACCACGCCCTGGGGCAACGAGAGCGAATGG
TCGCAGATGAGCCTGCTGAGCAACTTCCACAACGAGACCTTTGGCGGGGAGAAGTTCTTCCAGCTGCTCG
AGCGCCTGTCGCGCAATCCGGTCAAGCACCTGCCGATGCTGGAGCTGCTGTATCTGTGCCTGTCGCTCGG
CTTCGAAGGCAAATACCGCGTGCTGCCGCGCGGCATGCTCGAGCTGGAAGCCGTACGTGACAGCCTGTAC
CGGCAGATTCGCCAAATGCGTGGCGATGTTCCCCGCGAGCTGTCGCCGCATTGGGAGGGGCTGAAAGACA
CGCGGCGGCGCCTGGTGCGCATCGTACCGTGGTGGATGGTGGCGCTGTTCACCCTGGCCTGTCTCGGGGT
GATGTATAGCGGTTTCGCCTGGGTGCTCAGCGAGCAGCGCTCGACCGTTCTGCAACCGTACCAGTCGCTG
GATGCCGACTCGGTGGATTCACAGCTTTCGTCAGGGATGAATTGA