SecReT6
Protein ID: 397685918
SecReT6 ID682
T6SS typeN/A
Gene symbol-
Locus tagPSJM300_04005
StrainPseudomonas stutzeri DSM 10701
Repliconchromosome [GenBank: NC_018177] [Browse all T6SS(s) in this replicon]
Location [Strand]887911..890001 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI6ZXU5
KEGG IDpsj:PSJM300_04005
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-70, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 1.10E-70, Aligned region: 541..566
Phage_base_V [PF04717], Evalue: 8.00E-24, Aligned region: 392..485
DUF2345 [PF10106], Evalue: 0.00011, Aligned region: 558..588
DUF2345 [PF10106], Evalue: 0.00011, Aligned region: 595..637
Protein Sequence: 696 a.a.     [Download]
>gi|397685918|ref|YP_006523237.1| Rhs element Vgr protein [Pseudomonas stutzeri DSM 10701]
MFDSANESHFNLSIEGVEHDFKVLQFRGREAISQPYRFELEVVSERHDIDLQSLLHQSAFLAFTTDGAGV
HGQLHSVAQGQSGKRLTRYRLVLVPRLAYLAHRTNQQIHQHLSVPQIVAQVLEANGIQADGYRFQLGPTQ
YPERQYCVQYGETDLHFIQRLCAEEGIHYHFEHSAEGHVLVFGDDQTSFPRLGQPTAYVQDSGLVADEPV
IKSFGVRVETRPTRVSRRDYDFEKPRLLMKAASQGEQNPQAAQPDLEDYDYPGRFSDRTRGKHLSQRNLE
RHRSDYRLADGRSDQPNLVAGHLLEISEHPRREWNDLWLLNEVIHEGKQPQVLEESITLSPGSHIQAPSP
LVGEGWGEGAAFTQGYRNHFTATPWELPYRPPFDYPKPKVLGSQTAVVTGPAGEEIHCDEYGRVKVQFYW
DREGLLDDKSSCWLRVSSNWAGDRYGGIAIPRVGMEVLVTFLEGDPDRPLVTGCLYHAEHVPPYELPANK
TCSVFKTLSSPGGDGYNELRIEDRKGAEQIYVHAQRDWDQNIQHDQKIRVGHERHDTVEANSYSEFRAEE
HLTVTGERKVEVKPQDHLTVALDQHVQLGSAQLTRAGREIHLKAGQKMVIEAGIELTLKAGGSFVKLDPG
GITISGPLARINAGGAPGRGSGIGIKSPLPPGIADSDRAGEVLEQAQPNESARTLAKRKRMLNFSG
 
Nucleotide Sequence: 2091 bp     [Download]
>gi|397685123|ref|NC_018177.1|:887911-890001 Pseudomonas stutzeri DSM 10701 chromosome, complete genome
ATGTTCGATTCGGCCAATGAAAGCCATTTCAACCTGAGCATCGAGGGCGTCGAGCACGACTTCAAGGTGC
TCCAGTTCCGTGGCCGCGAGGCGATCAGCCAGCCTTATCGCTTCGAGTTGGAGGTCGTCAGCGAACGCCA
CGATATCGATCTGCAAAGTCTTCTGCATCAGTCGGCCTTTCTCGCCTTCACAACCGATGGTGCAGGTGTT
CACGGTCAGCTCCATAGTGTCGCGCAGGGGCAATCCGGCAAGCGTCTGACCCGCTACCGATTGGTGCTTG
TGCCGCGGCTGGCCTATCTCGCCCATCGAACCAACCAGCAGATCCACCAGCACCTCAGCGTGCCGCAGAT
CGTCGCCCAGGTGCTCGAGGCGAATGGCATCCAGGCCGATGGTTATCGCTTTCAGCTGGGGCCGACCCAA
TACCCTGAGCGCCAATACTGCGTGCAGTACGGCGAAACCGATCTGCACTTCATCCAGCGTCTATGCGCGG
AAGAGGGCATCCATTACCACTTCGAGCACAGCGCCGAAGGGCATGTGCTGGTGTTCGGTGATGACCAGAC
CAGTTTCCCGCGCCTCGGTCAACCGACAGCCTATGTTCAGGACAGTGGCCTGGTTGCCGACGAGCCGGTG
ATCAAAAGTTTCGGCGTGCGCGTGGAGACCCGTCCCACTCGGGTGTCGCGCCGCGATTACGATTTCGAGA
AACCCCGCCTGCTGATGAAGGCTGCCAGCCAGGGCGAACAGAATCCCCAAGCTGCTCAGCCCGATCTGGA
GGACTACGACTATCCTGGTCGCTTCAGCGACCGTACTCGCGGCAAGCACCTCTCACAGCGCAATCTCGAA
CGCCATCGCAGCGACTACCGACTCGCCGATGGCCGCAGTGACCAGCCCAACCTGGTCGCTGGTCATCTCC
TGGAAATCTCCGAACACCCCCGCCGGGAATGGAACGACCTCTGGTTGCTCAATGAAGTCATCCATGAAGG
CAAACAGCCGCAGGTGCTGGAAGAGTCGATCACTCTTTCTCCAGGCTCGCACATTCAAGCTCCCTCTCCC
CTTGTGGGAGAGGGTTGGGGAGAGGGGGCAGCATTCACCCAAGGCTACCGCAACCACTTCACTGCCACCC
CCTGGGAGCTACCTTATCGCCCGCCATTCGATTATCCGAAACCCAAGGTGCTCGGCAGCCAGACCGCCGT
AGTGACCGGCCCAGCCGGCGAAGAAATCCACTGCGACGAATATGGTCGTGTGAAAGTCCAATTTTATTGG
GATCGCGAAGGCCTGTTGGACGACAAGAGCAGTTGCTGGCTGCGCGTATCGAGCAACTGGGCCGGCGACC
GTTATGGCGGCATCGCCATTCCACGCGTCGGTATGGAAGTGCTGGTCACCTTTCTCGAAGGCGATCCCGA
CCGGCCGCTGGTCACCGGCTGCCTGTACCACGCCGAACATGTTCCACCCTACGAATTGCCGGCGAACAAG
ACCTGTAGTGTCTTCAAGACGCTCAGCAGCCCTGGTGGCGACGGCTACAACGAGCTGCGCATCGAGGACA
GGAAGGGCGCCGAGCAGATTTATGTTCATGCCCAGCGAGACTGGGACCAGAACATCCAGCACGATCAGAA
GATCCGCGTCGGCCACGAGCGTCATGACACCGTCGAGGCCAACAGCTACAGCGAGTTTCGTGCAGAGGAA
CACCTGACCGTGACTGGCGAGCGCAAGGTGGAAGTCAAGCCGCAGGACCACCTGACCGTAGCCCTCGATC
AGCACGTCCAGTTGGGCAGTGCACAACTGACCAGGGCCGGCCGTGAGATCCACCTCAAGGCCGGGCAGAA
AATGGTCATCGAAGCCGGTATCGAACTGACCCTCAAGGCCGGCGGCAGCTTCGTCAAGCTCGATCCGGGC
GGCATTACCATCAGCGGCCCGCTGGCCAGGATCAACGCTGGCGGCGCACCGGGTAGAGGCTCGGGTATCG
GCATCAAGTCGCCGCTGCCGCCGGGCATCGCCGATAGCGACAGGGCGGGGGAAGTGCTGGAGCAGGCGCA
ACCGAATGAGTCGGCCAGGACGCTGGCGAAGCGTAAACGGATGCTCAACTTCTCCGGTTAA