SecReT6
Protein ID: 397692803
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0033
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]30683..32668 [+]
ProductvgrG protein
NoteTssI
UniProt IDI7BP60
KEGG IDppx:T1E_0033
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-55, Aligned region: 28..348
Phage_base_V [PF04717], Evalue: 9.10E-20, Aligned region: 391..484
Protein Sequence: 661 a.a.     [Download]
>gi|397692803|ref|YP_006530683.1| vgrG protein [Pseudomonas putida DOT-T1E]
MPSQSDLRYSFEALVGKAEFEVVSFELREGISAPFELELKLISFENDIDFGHLLDKPVLFTILEGERPVR
YVHGLVSRFSQAESGFYRTYYHALVEPQLARAKLRSNWRIFQHKTVPQILELMLKRQGIDQYELRASMDH
QVREFCVQAGETDLAFIARLAAEEGFVYRFAHSEKLHKLIITDRLQSLGLISHGAIKADDEDEGFCDDDE
PVGPDSVLYQANSGGDQAIPCLRRLRYTEQVRTARQVQRDHTFTHPAYRQEHRAAGPFLEHQSKEYEYFD
YPGRYKRDAVGKPFTENRITALRHDVRIAEVQGDDVRLQPGLSFTLTGHPRDDLNAHWRVNTVTHKGHQF
TSLQEEAAGADVSTRYEQTAVLVPGRTEWRPAPLKKPRIDGPHMATVVGPPGEEIYCDEWGRVKVSFPWD
RESQNNEFSSCWLRVSQGWAGSSWGSMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGDQLPPYDLPDHKT
RMTIKSQTHKGEGFNELRFEDELGKEEVFIHAQRDQNTLVNHNQSLSVGVDRTQQVGQDESVAIGRNRLR
VVKANDTVKVGGGKNDLIAGDYEVEAGNSLRLKCGKTLIEMHANGTLNITCETFNFTAQQTGQINTLAAK
LDLNPTGGSAGAGANGRDSDSLKADVDGHFD
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|397692770|ref|NC_018220.1|:30683-32668 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCCTAGCCAATCTGATTTGCGCTACAGCTTTGAGGCTCTCGTTGGCAAAGCTGAATTCGAAGTGGTGT
CGTTCGAACTCCGAGAGGGCATCAGCGCACCCTTTGAACTGGAGCTGAAACTGATCAGCTTCGAAAACGA
TATCGACTTCGGCCATTTGCTCGACAAACCCGTGCTCTTCACCATCCTGGAGGGCGAACGCCCGGTACGG
TACGTGCACGGCCTTGTCAGCCGTTTCAGCCAGGCTGAAAGCGGCTTCTACCGCACCTATTATCACGCGC
TGGTCGAGCCCCAACTGGCACGGGCCAAACTGCGCTCGAACTGGCGCATCTTCCAGCACAAGACCGTTCC
GCAAATTCTCGAGCTGATGCTCAAGCGCCAGGGCATTGACCAGTACGAACTGCGCGCCAGCATGGACCAT
CAGGTGCGCGAATTCTGCGTTCAGGCCGGTGAGACGGACTTGGCGTTCATCGCCCGCCTGGCCGCTGAAG
AAGGCTTCGTCTACCGCTTCGCGCACAGTGAAAAGCTGCACAAGCTGATCATCACCGATCGGCTGCAGTC
CCTCGGCCTGATCAGCCATGGCGCCATCAAGGCCGACGATGAAGACGAGGGCTTCTGCGATGACGACGAG
CCGGTAGGCCCTGACAGCGTGCTGTACCAAGCCAACAGCGGTGGCGATCAAGCCATACCCTGCCTTCGCC
GCTTGCGCTACACCGAGCAGGTGCGCACCGCTCGTCAGGTGCAGCGCGACCACACCTTCACCCACCCGGC
CTACCGCCAGGAGCACAGAGCCGCCGGGCCCTTCCTGGAGCATCAGAGCAAAGAGTACGAATACTTCGAT
TACCCAGGCCGCTATAAACGCGATGCCGTGGGCAAGCCGTTCACCGAAAACCGCATCACAGCGCTGCGCC
ATGATGTGCGTATTGCCGAGGTCCAGGGCGATGACGTGCGTCTGCAACCGGGGCTCAGTTTCACCCTGAC
CGGTCACCCACGTGACGACCTCAATGCGCATTGGCGGGTCAACACGGTTACCCATAAAGGCCACCAGTTC
ACCAGCCTGCAGGAAGAAGCCGCCGGCGCCGATGTAAGCACGCGCTACGAGCAGACCGCAGTGCTGGTCC
CCGGTCGGACCGAATGGCGCCCTGCGCCATTGAAAAAACCACGAATCGACGGGCCGCACATGGCCACCGT
CGTCGGCCCGCCTGGCGAGGAAATCTACTGCGATGAATGGGGCCGGGTAAAAGTCAGTTTCCCCTGGGAC
CGCGAAAGCCAGAACAACGAGTTCAGTTCGTGCTGGTTGCGGGTGTCTCAAGGCTGGGCGGGTAGCAGTT
GGGGCTCGATGGCCATCCCTCGGATCGGCCAGGACGTGATCATCCATTACGTCAACGGCGACCCCGACCA
GCCAATGATCACCGGGCGCACTTACTGCGGTGACCAACTGCCGCCTTACGACCTGCCCGATCACAAAACA
CGCATGACCATCAAGAGCCAGACCCACAAGGGGGAAGGTTTCAACGAGCTGCGTTTCGAGGATGAGCTGG
GCAAGGAGGAAGTGTTCATCCATGCCCAGAGAGATCAGAACACTCTGGTCAATCACAACCAGTCCCTCTC
TGTGGGCGTCGATCGCACCCAACAGGTTGGCCAGGACGAATCGGTCGCCATTGGCCGCAATCGTCTGCGC
GTCGTCAAGGCCAACGACACCGTGAAAGTGGGGGGTGGCAAAAACGACCTCATCGCAGGCGACTACGAAG
TCGAAGCGGGCAACTCGCTACGCCTCAAATGCGGCAAGACCCTTATCGAAATGCATGCCAACGGCACGCT
GAACATCACCTGCGAGACCTTCAACTTCACCGCACAGCAGACCGGGCAGATCAACACCCTGGCGGCAAAG
CTCGACCTCAACCCAACGGGTGGTTCGGCGGGCGCGGGCGCGAACGGGCGCGACAGTGACTCACTCAAGG
CTGACGTGGATGGGCATTTCGACTAG