SecReT6
Protein ID: 397692816
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0046
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]49799..50518 [-]
Producthypothetical protein
NoteTssL
UniProt IDI7ATF5
KEGG IDppx:T1E_0046
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-58, Aligned region: 50..237
Protein Sequence: 239 a.a.     [Download]
>gi|397692816|ref|YP_006530696.1| hypothetical protein T1E_0046 [Pseudomonas putida DOT-T1E]
MLEKSLPNDAPAPATSTASAQEQKPEPEPEPAYQGYPADPEFQLRGGCANLMLDAAAPLFGLVMRLRTLD
ELPNIKDVHQQVRIQIDSIREEIRQHGYEPAQLLAYSYGLCLYIDEAVMDRPWGKSSCWSHEPLLSIFHD
ETWGGEKFFTVLSRLMQEPKRYQDVLEFMYFALCLGLKGKYAIAPKGEESLNALIHQLHGIIRELRGPTP
EEVCDPYTNVAPRNFRMSRIWPWWSPLVI
 
Nucleotide Sequence: 720 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c50518-49799 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCTCGAGAAGTCGCTGCCCAACGACGCACCCGCACCTGCAACTTCCACTGCATCTGCACAGGAGCAGA
AGCCGGAGCCGGAGCCGGAGCCTGCATATCAGGGCTACCCCGCGGATCCGGAGTTTCAGCTCAGGGGTGG
CTGCGCCAATCTCATGCTGGATGCCGCGGCGCCCTTGTTCGGGCTGGTCATGCGCCTGCGCACGCTCGAT
GAACTGCCCAACATCAAAGATGTGCATCAGCAAGTACGTATTCAGATCGACAGCATCCGGGAAGAAATAC
GCCAGCACGGCTATGAGCCCGCTCAGTTGCTGGCGTACTCCTACGGCCTGTGCCTGTACATCGATGAAGC
GGTGATGGATCGGCCCTGGGGCAAAAGCAGTTGCTGGAGCCACGAGCCGCTGCTCAGCATCTTCCACGAT
GAAACCTGGGGCGGGGAAAAATTCTTCACCGTGCTTTCCCGCCTGATGCAGGAACCCAAGCGCTATCAGG
ACGTGTTGGAGTTCATGTACTTCGCACTGTGCCTGGGTTTGAAGGGCAAGTACGCCATCGCCCCCAAGGG
CGAAGAGTCACTGAACGCCCTGATCCACCAGCTCCACGGGATCATCCGCGAACTGCGCGGCCCCACCCCC
GAAGAAGTCTGCGACCCCTACACCAACGTCGCCCCCAGAAACTTCCGCATGAGCCGGATATGGCCGTGGT
GGAGCCCGTTGGTCATCTGA