SecReT6
Protein ID: 397692818
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0048
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]51970..52767 [-]
Producthypothetical protein
NoteTssJ
UniProt IDI7BP76
KEGG IDppx:T1E_0048
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.30E-23, Aligned region: 17..65
T6SS-SciN [PF12790], Evalue: 6.30E-23, Aligned region: 157..256
Protein Sequence: 265 a.a.     [Download]
>gi|397692818|ref|YP_006530698.1| hypothetical protein T1E_0048 [Pseudomonas putida DOT-T1E]
MSRLAFLMASLLIVLVGLPGCTSLSRATKVVLDHSLPIGPPKDAPTQVAFSINVSPTLNSNPNSVDVAAI
PESILEPSPYAVTLSAGDPHALTDKVGTLLAYLQAQFPAMSRVETGEEDQSEWARSPMEESSPGSYDAPT
VVLTLPGSKAEASGPVATPIAIKILQLRDDSLLRNSVYQLLDDDPAKALRSTYIRDDDYLLNPGQFKFIP
FEPIEPETRFVAVIGDYSNQQNATWQHVLRIPPRGHQIILSVLVNDAQILLKEEE
 
Nucleotide Sequence: 798 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c52767-51970 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAGCCGCCTGGCTTTCTTGATGGCGTCTCTGCTGATCGTGCTGGTCGGGCTGCCAGGTTGCACGTCCT
TGAGCAGAGCCACCAAGGTGGTGCTGGATCACTCGTTACCAATCGGGCCGCCCAAGGACGCCCCCACCCA
AGTCGCGTTCAGCATCAACGTCAGCCCAACGCTCAACAGCAACCCGAACAGTGTCGACGTGGCGGCCATC
CCTGAGAGCATCCTGGAACCCAGCCCCTACGCAGTCACCTTGAGTGCCGGCGATCCGCACGCACTGACCG
ACAAAGTCGGGACCTTGCTCGCATACCTGCAAGCGCAATTCCCCGCGATGTCCCGCGTGGAAACCGGCGA
AGAGGACCAAAGCGAATGGGCTCGCTCCCCGATGGAAGAAAGCTCGCCCGGCAGCTATGACGCCCCCACG
GTGGTGCTCACGCTGCCGGGCAGCAAGGCCGAAGCCAGCGGGCCTGTCGCCACACCGATTGCCATCAAGA
TTCTGCAACTGCGTGATGACTCCCTGCTGCGCAACAGCGTGTACCAACTGCTGGACGATGACCCCGCCAA
GGCACTGCGCAGTACCTACATCCGCGATGACGATTACCTGCTGAACCCAGGCCAGTTCAAGTTCATACCG
TTTGAGCCCATCGAGCCCGAGACCCGCTTCGTCGCGGTGATCGGCGACTACAGCAACCAGCAAAACGCGA
CCTGGCAGCACGTGTTGCGAATTCCGCCACGCGGCCACCAGATCATTCTCTCAGTGCTGGTCAATGACGC
GCAGATCCTGCTCAAGGAGGAGGAATGA