SecReT6
Protein ID: 397692819
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0049
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]52764..52967 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDI7B3N0
KEGG IDppx:T1E_0049
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 67 a.a.     [Download]
>gi|397692819|ref|YP_006530699.1| FHA domain-containing protein [Pseudomonas putida DOT-T1E]
MTLCIINLDQVQHTVTLRHRFDRTGGTIGSDGADWVIKDPMAAFKALAEAAPSTTAPLQQLTAGERP
 
Nucleotide Sequence: 204 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c52967-52764 Pseudomonas putida DOT-T1E chromosome, complete genome
TTGACCTTGTGCATCATCAATCTCGACCAGGTGCAGCATACCGTCACCCTGCGTCATCGGTTTGATCGCA
CGGGCGGCACCATCGGCAGCGACGGGGCCGATTGGGTGATCAAAGACCCCATGGCGGCGTTCAAGGCGCT
GGCTGAGGCGGCGCCATCAACCACGGCCCCGCTGCAACAGCTGACGGCGGGAGAGCGCCCATGA