SecReT6
Protein ID: 397692820
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0050
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]52973..53896 [-]
Producthypothetical protein
NoteTssG
UniProt IDI7C2K0
KEGG IDppx:T1E_0050
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-82, Aligned region: 14..290
Protein Sequence: 307 a.a.     [Download]
>gi|397692820|ref|YP_006530700.1| hypothetical protein T1E_0050 [Pseudomonas putida DOT-T1E]
MHGLHGDNLEPRWADEATRLRVRLASDPRLTFPVSDVYKAERMPGEDERYRVCTTFMGLHGTDSPLPTYY
LEQVAYEHAQGVGVRPAFFDFFNHYLLSLLHRIWRKYRYYIRFQPGARDGFSQYMFALLGLNDKQLRGDT
TLPWSRLLSFAGVIASRSRAPGTVAGIIAHCFDLTHVQIREFETRTVTTNSKQLVSLGRSNGELGSTFMV
GTRTRTRSSKFTIVISELDQAQLHDLLPSGINFGRLRALIDFLLRDGLAYDLELHLKQNALSPFCLHRSQ
GAYLGWTSFVDDHDGQISPVVRFRGRS
 
Nucleotide Sequence: 924 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c53896-52973 Pseudomonas putida DOT-T1E chromosome, complete genome
TTGCATGGCCTGCACGGCGACAACCTGGAACCGCGTTGGGCGGATGAGGCCACCCGGCTGCGCGTGCGTC
TGGCCAGCGACCCGCGCCTGACCTTTCCCGTCTCTGATGTGTACAAGGCCGAGCGGATGCCAGGGGAGGA
TGAGCGCTATCGCGTGTGCACCACGTTCATGGGGCTGCACGGTACCGACTCGCCCTTGCCCACCTATTAC
CTGGAACAGGTGGCCTATGAACATGCCCAGGGTGTAGGCGTGCGGCCGGCCTTCTTCGACTTCTTCAACC
ATTACCTGCTCAGCCTGCTGCACCGGATCTGGCGCAAGTACCGCTATTACATCCGTTTTCAACCTGGTGC
GCGCGACGGCTTCTCCCAGTACATGTTTGCCCTGCTCGGGCTGAACGACAAACAGCTGCGCGGCGACACG
ACACTGCCCTGGAGCCGCCTGCTCAGCTTTGCCGGGGTTATCGCCAGCCGCAGCCGCGCACCGGGGACCG
TCGCCGGCATCATCGCCCACTGCTTCGATCTGACGCACGTGCAGATCCGCGAATTCGAGACGCGCACGGT
CACCACCAACAGCAAACAGCTTGTAAGCCTCGGGCGCAGCAACGGCGAGCTTGGCAGCACGTTCATGGTC
GGCACCCGCACCCGCACCCGCAGCAGCAAGTTCACCATCGTCATCAGCGAACTCGACCAGGCGCAGCTGC
ATGACTTGCTGCCCAGCGGCATCAACTTCGGTCGCCTGCGCGCCTTGATTGATTTTCTGCTGCGCGATGG
CCTGGCGTATGACCTGGAGCTGCACCTGAAACAAAACGCACTGTCACCGTTCTGCCTGCACCGCAGCCAA
GGCGCCTACCTGGGCTGGACCAGCTTTGTCGATGACCACGATGGCCAGATCAGTCCCGTTGTCCGTTTCC
GGGGGCGCTCATGA