SecReT6
Protein ID: 397692821
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0051
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]53953..55719 [-]
Producthypothetical protein
NoteTssF
UniProt IDI7ATF9
KEGG IDppx:T1E_0051
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.00E-193, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|397692821|ref|YP_006530701.1| hypothetical protein T1E_0051 [Pseudomonas putida DOT-T1E]
MSLKDRFSEELRYLHELGNDFAKDNPQLARLLGKAGSDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQILWPNYLRPLPSATIIRFSPRKQSLSQSQHIPKGARLFSKPVDAVPCEFRTCTGVSLHPFEISAVSAT
QTLDSSVVRIGLQTLVERPLNTLGCARLDFHLSGDNRTALTLYLWIAQYLKYVSVIMDGEVRRLPANSIA
FPGFSPEEALLPYPRNVFDGYRILQEYFVFPKRFHFFSITGLEKLWPAQACPQVGIEFHFTRQLPDTLRV
GTEDFSLFCTPAVNLFKHSAEPIDLASEAAQVDLKPRSEAQSAYEIFSVDEVISTRTTTDGSTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEESLRGDGVTHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GVDDINVLTEVTPPLATYTNICAPTRPYRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRTYDFAALH
DIQQARTTGKRLDGIREIHTQPMDWLIKGQPIRGLHTQLKLDQTAFLCEGDLYLFGCVLAHFFALYASIN
SFHQLEVINATNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c55719-53953 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGTCACTGAAGGACAGATTCAGCGAAGAACTGCGTTACCTGCACGAGTTGGGAAACGACTTCGCCAAGG
ACAACCCCCAGCTTGCCCGGCTGCTAGGCAAGGCGGGCAGCGACCCCGATGTCGAGCGGTTGATGGAAGC
CTTTGCGTTTCTAACGGCCAAGCTTCGGCTGAAGCTGGAAGATGACCTGCCAGAACTCACCCACCCCATG
CTGCAGATACTGTGGCCCAACTACCTGCGCCCGTTGCCCAGCGCCACGATTATCCGATTCTCGCCACGCA
AACAATCGCTCAGCCAGTCACAGCACATTCCCAAAGGTGCAAGGTTGTTCTCGAAACCCGTGGACGCCGT
GCCCTGCGAGTTTCGGACCTGCACGGGAGTGAGCCTTCATCCGTTCGAAATCAGCGCCGTCAGCGCAACC
CAGACACTCGACAGCTCTGTGGTTCGCATCGGCCTGCAAACCTTGGTCGAACGGCCACTGAATACGTTGG
GCTGCGCCCGTCTGGATTTCCACCTGAGCGGCGACAACCGCACCGCTCTGACGCTTTATCTATGGATTGC
TCAATACCTCAAATACGTCAGCGTGATCATGGACGGCGAGGTGCGCCGGCTACCGGCCAACAGCATCGCG
TTCCCGGGTTTCAGCCCTGAGGAGGCCTTGCTGCCCTACCCGCGGAACGTGTTCGATGGCTACCGGATCC
TGCAGGAATACTTCGTGTTCCCGAAGCGCTTCCACTTCTTCAGCATTACCGGCCTGGAAAAGCTGTGGCC
GGCACAAGCCTGCCCGCAGGTGGGCATCGAGTTCCATTTCACGCGTCAACTGCCAGACACCCTTCGCGTT
GGCACAGAAGATTTCAGCCTGTTCTGCACCCCGGCTGTCAACCTGTTCAAGCACAGTGCCGAGCCCATCG
ACCTGGCCAGCGAGGCTGCCCAGGTCGACCTGAAGCCCAGAAGCGAGGCGCAGTCCGCTTACGAAATCTT
CAGTGTCGATGAAGTCATCAGCACCCGAACGACCACTGACGGAAGTACCGGTGAGCACCTGCGGACTTTT
CGCCCTTTCGAATCGTTCGCCCACGAAATCGAGCATGTCCAAGGCCGCACGGCGCTGTACTACCGCTGCC
AACTCGAAGAGTCCCTGCGCGGCGATGGCGTGACCCACCGCATCGCCTTCGTGCGCGCCGATGCCAACAG
CTACATAGGCGAGCTTGAAACGGCATCCATCGACCTGACCTGCACCAACAGGGACTTGCCGCTGGCGCTG
GGCGTGGATGACATCAACGTCCTCACCGAAGTCACGCCGCCCCTGGCGACCTATACCAACATCTGCGCCC
CCACCCGCCCCTACCGGCCCGTGCTGGATGGCCAGTTGCAGTGGGCGTTGATCTCCAACATGTCGCTCAA
CTACCTGTCGCTGCTGTCGGTCGAGCCGCTCAAGGCGGTGATTCGCACCTACGACTTCGCGGCGTTGCAC
GACATCCAGCAAGCGCGCACCACCGGCAAACGCCTCGACGGTATCCGCGAAATCCACACGCAGCCCATGG
ACTGGCTGATCAAGGGGCAACCCATCCGAGGCCTGCACACCCAACTGAAGCTGGACCAGACGGCCTTCCT
CTGCGAAGGCGACCTCTACCTGTTCGGCTGCGTGCTCGCGCACTTCTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCATCAACTGGAAGTGATCAACGCCACCAACAACGAGCACTACACATGGCCCATCCAGACCGGCA
AGCAACCGCTGATCTAG