SecReT6
Protein ID: 397692823
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0053
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]56130..57617 [-]
Producthypothetical protein
NoteTssC
UniProt IDI7BP82
KEGG IDppx:T1E_0053
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-182, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|397692823|ref|YP_006530703.1| hypothetical protein T1E_0053 [Pseudomonas putida DOT-T1E]
MPKPSTTVTVETQAETLSNATLLDQIMAETKLVPTQEGYQVARQGVSAFIAEILKSHDPDQLINKHRVDQ
MIAELDRVLSKQMDAILHEPAFQQLESAWRSLKLLVDRTDFRENIKLEVLHVSKEDLLDDFENAADITCS
GIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFIAAPSPEFFNLSSFEALP
NLKEIKDIFAGPRHAKWRAFRESEDARHIALTGPRFMLRSAYHHQDQPISSFHYDENINGRHDNYLWGSS
AFLLASCINDSFARYRWCPNIIGPQSGGAVEGLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIAL
TMRKDSDNAAFFSANSVQKPKNFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKERR
DLESELNKWIKQYVADQENPSADVRSRRPLRAARVEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLVG
RLDTQ
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c57617-56130 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCCAAAGCCAAGCACAACTGTCACTGTTGAAACACAGGCCGAAACACTGAGCAATGCCACCTTGCTCG
ACCAGATCATGGCAGAGACCAAGTTGGTTCCCACACAAGAGGGTTACCAAGTGGCCAGGCAGGGTGTATC
CGCCTTCATTGCCGAAATTCTAAAAAGTCATGACCCAGATCAATTGATCAACAAACATCGCGTCGACCAG
ATGATTGCCGAGCTGGATCGGGTCCTCAGCAAGCAGATGGATGCCATTCTGCATGAACCCGCGTTCCAGC
AACTTGAATCCGCGTGGCGCAGCCTCAAACTTCTGGTCGACCGTACGGACTTTCGCGAGAACATCAAGCT
CGAAGTCTTGCACGTCAGCAAGGAAGACTTGCTCGATGATTTCGAGAACGCCGCCGACATTACCTGCAGT
GGTATTTATAAACACGTCTATACCGCCGGTTACGGCCAGTTCGGTGGCGAGCCGGTCGCGGCCATGGTTG
GCAATTACAACTTCGGCCCCTCTTCGCCTGATATCAAACTGTTGAGCTACATGGCATCCGTCGGCGCCAT
GTCGCATGCGCCCTTCATTGCGGCACCCTCCCCCGAGTTCTTCAACCTCAGCAGCTTCGAAGCGCTACCC
AATCTGAAAGAAATCAAAGACATCTTCGCCGGCCCACGGCATGCCAAGTGGCGCGCGTTCCGCGAGAGCG
AAGATGCCCGCCACATCGCGCTGACCGGGCCGCGCTTCATGCTGCGCTCCGCCTACCATCACCAGGACCA
GCCGATCAGCAGCTTCCATTACGATGAGAACATCAACGGCCGGCACGACAATTACCTGTGGGGCAGCTCA
GCCTTCCTGTTGGCCAGCTGCATCAACGACAGCTTTGCCCGCTACCGCTGGTGCCCCAACATCATCGGCC
CGCAATCGGGAGGTGCCGTCGAAGGCCTGCCGGTGCATCTGTACGAATCGCTGGGCCAGCTGCAGGCCAA
GATTCCTACCGAGGTACTGATTTCCGACCGCAAGGAATTCGAGCTGGCCGAAGAGGGCTTTATCGCCCTG
ACCATGCGCAAGGACAGCGACAACGCCGCGTTCTTCTCAGCCAACTCGGTGCAAAAGCCGAAAAACTTCC
CCAAGACACCCGAAGGCCTGCAGGCACAGACCAACTACAAGCTCGGCACCCAACTGCCCTACCTGTTCAT
CGTCAATCGCCTGGCCCACTACATCAAGGTGTTGCAGCGCGAGCAGATCGGCAGCTGGAAGGAGCGACGG
GACCTTGAGTCCGAACTCAACAAATGGATCAAGCAATACGTCGCCGACCAGGAAAACCCTTCGGCCGATG
TGCGCAGCCGTCGGCCGTTGCGTGCTGCCAGGGTCGAGGTCTCGGACGTGGCGGGTGATCCGGGCTGGTA
CCAGGTCTCGCTCGCCGTGCGCCCGCACTTCAAGTACATGGGCGCGAACTTCGAAATTTCCCTGGTAGGC
CGGCTCGACACGCAATGA