SecReT6
Protein ID: 397692824
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0054
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]57635..58138 [-]
Producthypothetical protein
NoteTssB
UniProt IDI7B3N5
KEGG IDppx:T1E_0054
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-54, Aligned region: 7..158
Protein Sequence: 167 a.a.     [Download]
>gi|397692824|ref|YP_006530704.1| hypothetical protein T1E_0054 [Pseudomonas putida DOT-T1E]
MTKPSDSVAPKERINIKYVPATGDEQAEVELPHKMMVLGDFGLDDSRSLEDRQVMRIDKHTFNNVLNDAD
VSLAMSVPSALGATPDAELAVNLQFKSIQDFGPDRIARQVPELNKLLQLREALVALKGPLGNVPTFRKQL
QHLLNDAHARKQLAQELDLVLEAPKAD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c58138-57635 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGACTAAACCCTCCGACTCCGTTGCACCCAAAGAACGCATCAACATCAAGTATGTGCCCGCCACCGGTG
ACGAGCAGGCCGAGGTAGAACTGCCGCACAAGATGATGGTGCTGGGCGACTTCGGCCTCGATGACAGCCG
CTCCCTCGAAGACCGTCAGGTCATGCGCATCGATAAACACACCTTCAACAACGTGTTGAACGACGCCGAT
GTGAGCCTGGCCATGTCGGTGCCCTCCGCGCTTGGCGCTACTCCGGATGCAGAGCTGGCAGTCAACCTGC
AATTCAAGTCCATCCAGGACTTCGGGCCAGACCGCATCGCACGCCAGGTGCCCGAGCTGAACAAGCTGCT
GCAGCTGCGTGAAGCGCTGGTCGCCCTGAAAGGCCCGCTGGGCAACGTGCCCACCTTCCGCAAACAGCTG
CAGCACCTTCTGAACGACGCGCATGCCCGCAAGCAACTCGCGCAAGAACTGGACCTGGTGCTTGAAGCGC
CAAAAGCCGACTGA