SecReT6
Protein ID: 397692826
SecReT6 ID683
T6SS typei1
Gene symbol-
Locus tagT1E_0056
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]59033..60499 [+]
Producthypothetical protein
NoteTssA
UniProt IDI7ATG4
KEGG IDppx:T1E_0056
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-18, Aligned region: 54..114
Protein Sequence: 488 a.a.     [Download]
>gi|397692826|ref|YP_006530706.1| hypothetical protein T1E_0056 [Pseudomonas putida DOT-T1E]
MSLVAEVEAQEITRLLAPIDTQVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWDYIEEASGQYLERQC
KHLRIVAHLSVAWLRSGCWERWGFTLALLGGMIEGYWETAHPAPGPKGFLTKRKVVGLVLNRLIDALPRL
DRFTYTPAHAAAAKGALARLLRQQEAAQLDPAVLVELERLLHKHTALANGIGECDAPKAPVESPQPAPLA
DVIATPKPCLSGGNERETRRAILSMAELINQQDPYDPTGYQLRRFGLWAHIQAAPQTRQGNRTELMAVPR
DIASDYEEAIAGTVIDAALLQRVEKSVSASPFWIRGSFLAASAASRLAMGEVAEAIRAATARFVLRMPAL
QQLCFSDGRVFVDDQCLAWLKGADGQSGQAGASQAFTNLREELVSQLESGGVEPVLLRLQGMQADFRAPR
ERCHTTVIAADLLAARGVSWLAQDLCAGVVRTMQQTTASDWEPEVFERLQQYASSHVLADRNKEQEPR
 
Nucleotide Sequence: 1467 bp     [Download]
>gi|397692770|ref|NC_018220.1|:59033-60499 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGTCGCTGGTAGCTGAGGTCGAGGCGCAAGAAATCACACGCTTGCTCGCACCCATTGATACCCAGGTGC
CGGCGGGGCTGTTCGATGTGGAAGACGAAACCTACCAAGCCATTGACCAGGAGATGGTCAAGCTGGGTGG
GCTACAGGAAGCCTCTATCGATTGGGACTACATCGAGGAGGCCTCTGGTCAGTATCTGGAGCGACAGTGC
AAGCATCTGCGGATCGTCGCGCACTTGAGCGTTGCGTGGCTGCGCAGTGGTTGTTGGGAGCGCTGGGGGT
TCACCTTGGCGTTACTGGGCGGAATGATCGAGGGCTATTGGGAAACCGCTCATCCAGCGCCTGGTCCGAA
GGGCTTCCTGACCAAGCGCAAGGTCGTTGGCCTGGTGCTCAATCGCTTGATCGATGCGCTGCCGCGCCTT
GATCGTTTCACGTACACCCCGGCTCACGCCGCAGCGGCGAAGGGTGCATTGGCCCGTTTGCTACGTCAGC
AGGAAGCCGCCCAGCTTGACCCGGCTGTTCTGGTTGAGCTGGAGCGCCTTTTGCACAAACACACGGCGCT
TGCCAACGGTATTGGTGAGTGCGATGCGCCCAAGGCCCCGGTGGAGAGCCCCCAACCTGCGCCGCTGGCG
GATGTCATCGCCACCCCGAAACCCTGCTTGTCGGGCGGTAACGAGCGCGAGACGCGCCGAGCCATCTTGA
GCATGGCCGAGCTGATCAATCAGCAGGACCCTTACGACCCGACCGGCTATCAACTGCGGCGCTTCGGTCT
GTGGGCCCACATTCAGGCCGCACCGCAAACCCGGCAGGGCAACCGTACAGAGTTGATGGCAGTGCCGCGG
GATATTGCCAGCGACTATGAGGAGGCCATCGCCGGCACGGTAATCGACGCAGCGTTGCTCCAGCGGGTCG
AAAAAAGTGTGTCGGCTTCGCCTTTCTGGATTCGCGGCAGCTTTCTTGCCGCATCTGCCGCGTCGCGGCT
GGCGATGGGCGAAGTGGCTGAGGCCATCCGTGCGGCGACCGCTCGTTTCGTGCTGCGCATGCCAGCGCTG
CAGCAGCTGTGCTTCAGCGACGGTCGGGTGTTTGTCGACGACCAATGCCTGGCCTGGCTCAAAGGGGCAG
ACGGGCAATCCGGGCAAGCCGGAGCTTCCCAAGCGTTCACCAACCTTCGCGAAGAACTGGTCAGCCAGCT
GGAAAGCGGCGGCGTAGAACCGGTGTTGCTAAGGCTGCAGGGGATGCAGGCAGATTTTCGAGCCCCTCGC
GAGCGCTGCCATACCACCGTCATCGCAGCTGACCTGTTGGCCGCACGAGGCGTGTCCTGGTTAGCCCAGG
ACCTGTGCGCTGGGGTAGTGCGCACGATGCAGCAAACCACCGCCAGCGACTGGGAGCCCGAGGTATTTGA
GCGGCTTCAACAATACGCGTCCTCCCACGTGCTGGCCGATAGGAACAAGGAGCAGGAGCCTCGATGA