SecReT6
Protein ID: 397693179
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0409
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]465662..467125 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDI7B4N1
KEGG IDppx:T1E_0409
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-18, Aligned region: 54..114
Protein Sequence: 487 a.a.     [Download]
>gi|397693179|ref|YP_006531059.1| ImpA domain-containing protein [Pseudomonas putida DOT-T1E]
MSVVAQVSREEVTRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWVYIEDASRQYLSQQC
KHLRIVAHLSAAWLRSGCWEQWGCTLALLAGMLECYWEAAHPKPGPKGFLGKRKLVALVIDRLAEALPRL
DRFTYTPTHAAAAQAALKRLQQQETVQLDTAALGELERLLGKYSELANGVGEAAVPKAPAATEKPAPLAD
VIATPVSRMSMGNERETRRAVLSMAELINQQDPYDATGYQLRRFGLWAHIQIAPQVRQGNRTELMAVPLD
ITRVYEEAIASKAVDPALLQRIEKSLTACPFWIRGSFLAATVATQLAMCEVAEAIRCATARFVQRMPSLQ
QLCFSDGLVFVDDQCLAWLKGTQGPSGQGATPQEFSGLREELVSQLETGGVEPLLLRLQGLQAGFRAPRE
RCHTTVIAADLLAARGVSWLAQDLCANVARTMQQTTASAWEPEVFQRLQQYAASPVLAVQDKDQEPR
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|397692770|ref|NC_018220.1|:c467125-465662 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGTCGGTGGTAGCGCAGGTATCCAGGGAAGAGGTCACTCGGTTGCTCGCGCCGATTGATCCGGCAGTTC
CGGCTGGCCTGTTCGATGTCGAGGACGAAACCTATCAGGCCATTGATCAGGAGATGGTCAAGCTGGGTGG
GCTGCAGGAAGCCTCGATCGACTGGGTCTACATCGAAGACGCGTCCCGTCAGTACCTGAGCCAGCAATGC
AAGCACTTGCGAATCGTTGCGCACCTGAGTGCCGCATGGTTGCGTAGCGGCTGCTGGGAGCAGTGGGGAT
GCACCTTGGCGTTGCTGGCCGGCATGCTCGAGTGCTATTGGGAAGCCGCTCATCCCAAGCCGGGACCGAA
AGGCTTCCTGGGCAAACGCAAGCTGGTTGCCCTGGTGATCGATCGCTTGGCCGAGGCGCTACCGCGTCTT
GATCGTTTTACCTACACCCCGACCCACGCAGCGGCAGCGCAGGCTGCCTTGAAACGCCTGCAACAACAGG
AAACGGTGCAGCTGGACACGGCAGCACTGGGCGAACTTGAGCGCCTGCTAGGCAAGTACTCGGAACTTGC
CAACGGTGTTGGCGAGGCTGCTGTGCCCAAAGCGCCGGCTGCAACCGAGAAGCCTGCGCCGTTGGCCGAT
GTCATCGCCACACCCGTGTCACGCATGTCGATGGGCAATGAGCGTGAGACACGGCGGGCCGTGCTGTCCA
TGGCCGAGCTCATCAACCAGCAGGACCCTTACGACGCTACCGGCTATCAGTTACGGCGTTTCGGTTTGTG
GGCGCACATTCAGATTGCTCCCCAGGTCAGGCAGGGCAACCGTACGGAATTGATGGCGGTGCCGCTGGAC
ATCACGCGGGTCTATGAAGAGGCCATTGCCAGTAAGGCGGTTGACCCCGCCTTGCTGCAGCGTATTGAAA
AGAGCCTGACGGCTTGCCCCTTCTGGATTCGTGGCAGCTTTCTGGCTGCGACCGTCGCCACACAGCTGGC
GATGTGCGAGGTGGCCGAAGCCATCCGTTGTGCCACCGCCCGGTTTGTACAGCGCATGCCGTCGCTGCAG
CAGTTGTGCTTCAGCGACGGGCTGGTATTTGTCGACGACCAGTGCCTGGCCTGGCTCAAGGGCACGCAAG
GGCCGTCTGGCCAAGGTGCAACCCCCCAGGAATTCAGCGGCCTGCGCGAGGAGTTGGTCAGCCAGCTGGA
AACCGGTGGCGTAGAACCGCTGCTCCTTCGGCTGCAAGGGCTGCAAGCGGGCTTTCGTGCTCCCCGTGAG
CGCTGCCACACCACCGTGATTGCAGCTGATCTGCTGGCCGCGCGGGGTGTGTCCTGGCTGGCCCAAGACC
TGTGCGCCAACGTTGCCCGAACCATGCAGCAAACCACCGCCAGTGCGTGGGAGCCCGAGGTGTTTCAGCG
GCTTCAGCAGTATGCGGCATCCCCAGTGCTGGCAGTTCAAGACAAGGATCAGGAGCCTCGATGA