SecReT6
Protein ID: 397693181
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0411
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]468090..468593 [+]
Producthypothetical protein
NoteTssB
UniProt IDI7AUH2
KEGG IDppx:T1E_0411
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-54, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|397693181|ref|YP_006531061.1| hypothetical protein T1E_0411 [Pseudomonas putida DOT-T1E]
MSKNTGSVAPKERVNIKYVPATSDEQAEVELPHKMLVLGDFGLDDNRALEDRQVMRIDKHTFNSVLNDAN
VSLDVTVPSRLGTAPDTELAVRLQFRSINDFGPDRIARQVPELNKLLALREALVALKGPLGNVPAFRKQL
QHLLNNEQARKQLAQELDLVLEAPEQD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|397692770|ref|NC_018220.1|:468090-468593 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGTCTAAAAATACGGGATCCGTTGCGCCGAAAGAACGCGTCAATATCAAGTATGTCCCCGCTACCAGCG
ATGAGCAGGCTGAGGTGGAGCTGCCGCACAAGATGCTGGTGCTGGGCGACTTCGGCCTGGATGACAACCG
TGCGCTTGAGGACCGTCAGGTCATGCGCATCGATAAACATACATTCAACAGCGTGTTGAACGACGCCAAC
GTAAGCCTGGACGTGACGGTACCGTCCAGGCTTGGCACCGCCCCGGATACCGAGCTGGCCGTCCGCCTGC
AGTTCAGGTCCATCAACGATTTCGGGCCGGACCGGATCGCGCGCCAGGTGCCCGAGCTGAACAAGCTGCT
GGCGCTGCGCGAAGCACTGGTCGCCCTGAAAGGCCCGCTGGGTAACGTCCCGGCCTTCCGCAAGCAATTG
CAGCACCTGCTTAACAACGAGCAGGCGCGTAAGCAGCTCGCCCAAGAACTGGACCTGGTGCTCGAGGCGC
CAGAACAAGATTGA