SecReT6
Protein ID: 397693182
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0412
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]468611..470101 [+]
Producthypothetical protein
NoteTssC
UniProt IDI7BZL4
KEGG IDppx:T1E_0412
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.20E-184, Aligned region: 70..494
Protein Sequence: 496 a.a.     [Download]
>gi|397693182|ref|YP_006531062.1| hypothetical protein T1E_0412 [Pseudomonas putida DOT-T1E]
MPKPSSTAITTDATADTLSNATLLDQIMAETKLVPAQEGYQIARQGVSAFITEILKSNDPDQLINKHRAD
QMIAEIDRMLGNQMDAILHQPEFQQLESSWRSLKLLVDRTDFRENIKLEVLHVTKEDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFLAAPAPEFFNLNSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEQPIESFNYNEGIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKHFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
RDLESELNKWIKQYVADQENPSADVRSRRPLRAARIEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|397692770|ref|NC_018220.1|:468611-470101 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGCCCAAGCCAAGCAGCACCGCCATCACCACAGACGCAACGGCCGACACATTGAGCAATGCCACCCTGC
TCGACCAGATCATGGCAGAAACCAAACTGGTACCTGCCCAGGAGGGCTACCAGATTGCCAGGCAGGGCGT
ATCTGCCTTCATCACCGAAATACTCAAAAGCAATGACCCAGATCAACTGATCAACAAGCACCGAGCCGAC
CAGATGATTGCCGAGATCGACCGAATGCTCGGCAATCAGATGGATGCCATTCTGCATCAGCCTGAGTTCC
AGCAGCTTGAATCATCATGGCGCAGCCTTAAACTTCTGGTCGACCGCACGGACTTCAGGGAGAACATCAA
GCTTGAAGTCTTGCATGTCACGAAAGAGGACCTGCTCGACGACTTCGAAAATGCTGCTGACATTACCTGC
AGCGGTATCTACAAGCATGTTTACACCGCGGGTTATGGCCAATTCGGGGGAGAGCCGGTTGCGGCCATGG
TAGGCAACTACAACTTCGGCCCCTCTTCCCCTGACATCAAGTTGCTAAGTTACATGGCCTCCGTTGGCGC
CATGTCCCATGCCCCTTTTCTTGCTGCACCTGCCCCCGAATTTTTCAATTTGAACAGCTTCGAGGAGCTG
CCTAACCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCATGCCAAGTGGCGCGCTTTTCGTGAAA
GCGAAGACGCCCGCCACGTCGCCCTGACCGGGCCGCGCTTCATGCTTCGCTCCGCTTACCACCCGCAGGA
ACAACCGATCGAGAGCTTCAACTACAACGAAGGCATCGCCGGGCAGCACGACAACTACCTGTGGGGCAAT
TCTGCTTTTCTGTTAGCCAGTTGCATCAACGACAGCTTCGCCCGCTACCGCTGGTGCCCGAATATCATCG
GCCCCCAATCCGGCGGTGCTGTCGAAGACTTGCCGGTCCACCTGTACGAATCCCTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTGCTGATATCCGACCGCAAGGAATTCGAACTGGCCGAAGAGGGCTTCATCGCC
CTGACCATGCGCAAAGACAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTACAAAAGCCCAAGCACT
TCCCAAAAACCCCTGAGGGGCTTCAGGCACAGACCAACTACAAGCTGGGTACCCAGTTGCCCTACCTGTT
CATCGTCAACCGGCTCGCCCACTACATCAAGGTGCTGCAGCGCGAGCAGATCGGCAGTTGGAAAGAGCGC
CGTGACCTTGAGTCCGAGCTGAACAAATGGATCAAGCAGTACGTCGCCGACCAGGAGAACCCGTCTGCCG
ACGTTCGCAGCCGCCGGCCGCTGCGTGCCGCCCGTATTGAGGTCTCGGATGTTGCGGGTGACCCGGGCTG
GTACCAGGTTTCGCTCGCCGTACGTCCGCACTTCAAGTACATGGGCGCGAACTTCGAGATTTCCCTGGTC
GGGCGGCTCGATACGCAATGA