SecReT6
Protein ID: 397693183
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0413
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]470098..470508 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDI7BQ90
KEGG IDppx:T1E_0413
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 25..119
Protein Sequence: 136 a.a.     [Download]
>gi|397693183|ref|YP_006531063.1| GPW/gp25 family protein [Pseudomonas putida DOT-T1E]
MSGLFDRLMVDQCICREASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDVSNGDLLVQ
VSADIRRTLQRFEPRIQVRTLNAVPDTLAPLELHFRLDCLVQVNNHAEQLQLELLVDGHNRYTRVR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|397692770|ref|NC_018220.1|:470098-470508 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGAGTGGTCTTTTTGATCGCCTGATGGTGGACCAGTGCATCTGCCGAGAGGCCTCCCGACGCGAGAGCG
CTTCCCACAAGTTCGCCGCCATCAAGCGCCACCTCGAAACGCTACTGAATGCCCGCCAGGGGTGCTCCCA
GAGCAGCCCTGAGCTGGGCCTGCGCGACTTCAACGGGCATGACGTGAGCAACGGCGACTTGCTTGTGCAG
GTGAGCGCGGATATCCGCCGCACACTCCAGCGCTTCGAGCCGCGCATACAGGTACGCACGCTCAACGCAG
TGCCCGATACCCTTGCCCCGCTGGAGCTGCATTTCAGGCTGGATTGCCTGGTACAGGTCAACAACCACGC
AGAGCAGCTGCAACTCGAGCTGCTGGTCGATGGGCACAACCGCTACACGCGCGTGAGGTGA