SecReT6
Protein ID: 397693184
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0414
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]470512..472278 [+]
Producthypothetical protein
NoteTssF
UniProt IDI7B4N6
KEGG IDppx:T1E_0414
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-192, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|397693184|ref|YP_006531064.1| hypothetical protein T1E_0414 [Pseudomonas putida DOT-T1E]
MSLRDRFSEELRYLHELGNDFAKDNPQLARLLGKGASDPDVERLMEAFAFLTAKLRLKLEDDLPELTHPM
LQLLWPNYLRPLPSATIIKFSPVRQSLSQSQRIPKGSRLFSKPVDGVACEFRTCTAVNIHPFEIDTVAAT
QTSDSSVICIGLQSLAERPLNSLGCTSLDFYLSGDTRTARTLYLWVSQYLKHVSVTINDVVRRLPANSIA
FPGFSPNDALLPYPQNVFDGYRILQEYFAFPQRFHFFSVTGLEKIWPAHDSQQVNLEFHFTRQLPDSLRV
DKADFNLFCAPAVNLFQHSAEPIDLSGKDAMVPLKPKGTAPYGYEIFSVDQVISTRTTTDGNTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEECLHGNGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINVLTELTPPLATYTNLCTPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRAYDFMALH
DIQQARTTRKRLEGMRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEGDLYLFSCVLAHFFALYASIN
SFHQLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|397692770|ref|NC_018220.1|:470512-472278 Pseudomonas putida DOT-T1E chromosome, complete genome
ATGTCACTGAGAGACCGTTTCAGCGAAGAACTGCGTTACCTGCACGAACTGGGGAACGACTTTGCCAAGG
ACAACCCACAACTCGCGCGGTTGCTTGGCAAAGGTGCCAGCGACCCCGATGTCGAACGCCTGATGGAAGC
CTTTGCGTTCCTGACCGCCAAGCTACGGCTGAAGCTGGAAGACGACTTGCCAGAGCTGACCCATCCCATG
CTGCAGTTGCTCTGGCCGAACTACCTGCGGCCGCTGCCCAGCGCGACGATCATCAAGTTCAGCCCGGTGA
GGCAATCCCTCAGCCAGTCACAGCGCATCCCAAAGGGGTCGCGGCTGTTCTCGAAACCGGTAGACGGCGT
GGCCTGCGAGTTCCGCACCTGTACAGCGGTCAACATTCATCCGTTCGAGATCGACACGGTGGCAGCCACC
CAGACATCCGACAGTTCTGTGATCTGCATCGGCCTTCAATCACTGGCCGAGCGGCCGTTGAACAGCCTGG
GCTGTACCAGCCTCGACTTTTACCTCAGCGGCGATACTCGTACCGCCCGCACGCTTTACCTGTGGGTTTC
CCAATACCTCAAGCATGTCAGCGTGACCATCAATGACGTGGTTCGTCGGCTGCCGGCAAACAGCATCGCA
TTCCCAGGGTTCAGCCCCAACGACGCCTTGCTGCCTTACCCACAGAACGTCTTTGATGGCTACCGGATCC
TGCAGGAATACTTCGCATTCCCCCAACGCTTCCACTTTTTCAGCGTTACTGGGCTTGAAAAGATCTGGCC
AGCTCATGACAGCCAGCAGGTAAACCTCGAATTTCACTTCACGCGCCAGCTACCCGACTCGCTGCGTGTC
GACAAAGCAGATTTCAACCTGTTCTGCGCACCTGCGGTCAACCTGTTCCAGCACAGCGCCGAGCCCATCG
ACCTGTCCGGCAAGGACGCCATGGTTCCACTGAAGCCCAAGGGCACAGCGCCGTACGGCTACGAAATCTT
CAGTGTCGACCAGGTGATCAGCACCCGAACGACGACTGACGGGAACACCGGTGAGCACCTTCGGACCTTC
CGTCCCTTCGAGTCATTCGCCCATGAAATCGAGCACGTCCAGGGGCGCACGGCGCTGTATTACCGCTGCC
AGCTGGAAGAGTGCCTGCACGGCAATGGCGTCATGCATCGAATCGCCTTCGTCCGCGCCGACGCCAACAG
CTACATAGGCGAGCTGGAAACCGCGTCCATCGACCTCACTTGCACTAATCGGGACCTCCCGCTGGCGCTG
GGCATCGATGACATCAACGTTCTGACCGAACTTACGCCGCCTCTGGCCACCTACACCAATCTCTGTACAC
CCACCCGCCCCTGTCGCCCGGTGCTGGACGGCCAGTTGCAGTGGGCATTGATCTCCAACATGTCGCTCAA
CTACCTGTCCTTGCTCTCGGTAGAGCCGCTGAAAGCGGTGATCCGCGCCTACGACTTCATGGCACTGCAC
GACATCCAGCAGGCCCGCACCACCCGTAAACGCCTGGAAGGTATGCGCGACATTCATACGCAGCCCATGG
ATTGGCTGATCAAGGGGCAACCCATTCGCGGCCTGCACACCCGGCTGAAACTGGACCAGACCGCCTTCCT
CTGCGAAGGCGACTTGTACCTGTTCAGCTGTGTGCTCGCTCATTTCTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCACCAGCTGGAAGTGATCAACACCACCAATAACGAGCACTACACATGGCCAATACAGACCGGCA
AGCAACCGCTGATCTAG