SecReT6
Protein ID: 397693185
SecReT6 ID684
T6SS typei1
Gene symbol-
Locus tagT1E_0415
StrainPseudomonas putida DOT-T1E
Repliconchromosome [GenBank: NC_018220] [Browse all T6SS(s) in this replicon]
Location [Strand]472335..473258 [+]
Producthypothetical protein
NoteTssG
UniProt IDI7C3J4
KEGG IDppx:T1E_0415
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-80, Aligned region: 15..290
Protein Sequence: 307 a.a.     [Download]
>gi|397693185|ref|YP_006531065.1| hypothetical protein T1E_0415 [Pseudomonas putida DOT-T1E]
MHGLHGDDLEPRWPDKATRRRVRLACDPRLTFPVSDVYKAQRMPAEEARYRIIATFLGLHGTDSPLPTYY
LEQVAYEHAHGIGVRPAFFDFFNHYLLSLLHRIWRKYRYYIRFQPGASDGFSQYVFALLGLNDKQLRGDT
ALPWSRLLSFAGVIASRSRAPGTVAGIIAHCFDLKQVHIREFETRSVVTPSRQLARLGRTNGQLGSTFMI
GSRTRTRSSKFTIVISELDQTQLRDLLPSGINFGRLRALIDFLLRDGLAYDLELRLKQSALSPFCLHRSQ
GAYLGWTSFVDDRHGQISPVVRIRGRS
 
Nucleotide Sequence: 924 bp     [Download]
>gi|397692770|ref|NC_018220.1|:472335-473258 Pseudomonas putida DOT-T1E chromosome, complete genome
TTGCACGGGCTGCATGGCGATGACCTGGAACCCCGTTGGCCGGACAAGGCCACCCGGCGGCGCGTGCGCC
TGGCCTGCGACCCACGGCTGACCTTCCCTGTTTCGGACGTGTACAAAGCCCAGCGGATGCCCGCTGAGGA
AGCGCGCTACCGCATCATTGCCACATTCCTGGGGTTGCACGGCACCGATTCGCCATTGCCCACCTATTAC
CTGGAACAGGTGGCGTATGAACATGCGCATGGCATCGGTGTACGGCCGGCCTTCTTCGACTTTTTCAACC
ATTACCTGCTCAGCCTGTTGCACCGTATCTGGCGCAAGTACCGCTATTACATCCGCTTCCAGCCAGGTGC
CAGTGACGGGTTCTCGCAGTACGTGTTTGCCCTGCTTGGGCTTAACGACAAGCAGTTGCGAGGGGACACG
GCGCTGCCCTGGAGCCGCCTGCTCAGTTTTGCCGGCGTGATCGCCAGCCGCAGCCGTGCGCCGGGCACTG
TGGCCGGCATCATTGCGCACTGCTTCGACCTCAAGCAGGTGCACATCCGCGAGTTCGAGACGCGATCAGT
CGTCACGCCGTCCAGGCAGCTTGCAAGGCTGGGGCGGACCAACGGCCAGCTGGGCAGCACGTTCATGATC
GGCAGCCGCACGCGCACTCGCAGCAGCAAGTTCACCATCGTGATCAGCGAACTCGACCAGACACAGCTGC
GGGACTTGCTGCCCAGCGGCATCAACTTCGGCCGTTTGCGTGCACTGATCGACTTTCTGCTGCGTGACGG
GCTGGCCTACGACCTGGAACTGCGCCTTAAGCAGAGCGCGTTGTCCCCCTTCTGCTTGCACCGCAGCCAG
GGCGCATACCTGGGCTGGACCAGCTTCGTCGACGACCGGCATGGCCAGATCAGCCCGGTTGTACGCATCC
GGGGGCGCTCATGA